SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000008439 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000008439
Domain Number 1 Region: 509-581
Classification Level Classification E-value
Superfamily TPR-like 0.000000114
Family Tetratricopeptide repeat (TPR) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000008439   Gene: ENSPCAG00000009008   Transcript: ENSPCAT00000009040
Sequence length 615
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2603:68590:103337:-1 gene:ENSPCAG00000009008 transcript:ENSPCAT00000009040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKSHKDSSCPSVGTSVSSLHEALDQCMTALDLFLTNQFSEALNYLKPRTKESMYHSLT
YATILEMQAMMTFDPQDILLAGNMMKEAQSLCQRHRKKSSVTDSFSSLVHRAAVDQFTEE
EIHAEVCYAECLLQRAALTFLQGASYSAQGGAPRPRALLDPSQAYGSLPRPSSHLSLLQD
ENMVSFIKGGIKVRNSYQTYKELDSLVQSSQYCRGENHGHFEGGVKLGVGAFNLTLSMLP
TRILRLLEFVGFSGNKDYGLLQLEEGASGHSFRAVLCVMLLLCYHTFLTFVLGTGNVDIE
EAEKLLMPYLKRYPKGAIXXXXXXXXXXXXXXXXXAVRRFEECCEAQQHWKQFHHMCYWE
LMWCFTYKSQWKMAYFYADLLSKENSWSKATYIYMKAAYLSMFGEEDYKPFGDDEVELFR
AVPSLKLKIAGKSLPTEKFAIRKSRRYLSPNPVSLPIPALXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXNEYSVDDECLVKLLKGLCLKYLGRIQEAEENFRSISASEKKI
KYDHYLIPNALLELALLFMEQGRNEEAVKLLETAKQNYKNYSMESRTHFRIQAAMLQAKS
SLENGSSAMISSVSL
Download sequence
Identical sequences ENSPCAP00000008439 ENSPCAP00000008439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]