SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011460 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011460
Domain Number 1 Region: 226-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 185-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-18
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 3 Region: 267-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000151
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 72-112
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000366
Family KRAB domain (Kruppel-associated box) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011460   Gene: ENSPCAG00000012311   Transcript: ENSPCAT00000012272
Sequence length 328
Comment pep:known_by_projection scaffold:proCap1:scaffold_6772:55436:58490:-1 gene:ENSPCAG00000012311 transcript:ENSPCAT00000012272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPGEARQQDVPLVGPEAKPTVQRAQAKGPPSQMGTQSRLPREQPCHGAQPSVLPKERSPR
ESMDACPASGVHGPVTFGDIPFYFSREEWGSLDPAQRDLFWDIKRENSRSIALGLGLKSK
KEGSLLTETVTSPTQAGSDVAVSWSPEEAEAWESENQPGVPLGRVGGARRGRPPTRRRQF
QDLATEKPHSCGQCGKRFRWGSDLARHQRTHTGEKPHKCQACDKCFRSSSDLVRHQGVHT
GQKPFSCSECGKSFSRSAYLADHQRIHTGEKPFGCGDCGKSFSLRSYLLDHRRVHTGERP
FGCGECDSFKQRAHLIVHQSLHAKMAQP
Download sequence
Identical sequences ENSPCAP00000011460 ENSPCAP00000011460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]