SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013793 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013793
Domain Number 1 Region: 316-512
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.98e-69
Family Hemopexin-like domain 0.00000746
Further Details:      
 
Domain Number 2 Region: 114-270
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-52
Family Matrix metalloproteases, catalytic domain 0.000000212
Further Details:      
 
Domain Number 3 Region: 20-84
Classification Level Classification E-value
Superfamily PGBD-like 5.65e-16
Family MMP N-terminal domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013793   Gene: ENSPCAG00000014773   Transcript: ENSPCAT00000014764
Sequence length 588
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2764:66:57662:1 gene:ENSPCAG00000014773 transcript:ENSPCAT00000014764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAAGAGGRAAGKAARAAETEAPFPGQSWLKSYGYLLPYDSRASALHSGKALQSAVSTMQ
QFYGIPVTGVLDQTTIEWMKKPRCVPDPHLSRRRRNKRYALTXXXXXXXXXXXXIHNYTP
KVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDG
EGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPS
AIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHER
QPRPPRPPFGDRPSTPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQ
IEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPREGID
TALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEGYYTY
FYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQKEAERRKERRLPQDDVDIMVTINDMP
GSVNAVAVVIPCILSLCILVLVYTIFQFKNKAGPQPVTYYKRPVQEWV
Download sequence
Identical sequences ENSPCAP00000013793 ENSPCAP00000013793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]