SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014297 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014297
Domain Number 1 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 4.71e-26
Family L27 domain 0.00011
Further Details:      
 
Domain Number 2 Region: 143-182
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000015
Family PDZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014297   Gene: ENSPCAG00000015315   Transcript: ENSPCAT00000015289
Sequence length 197
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1816:169629:180468:-1 gene:ENSPCAG00000015315 transcript:ENSPCAT00000015289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQT
Download sequence
Identical sequences ENSPCAP00000014297 ENSPCAP00000014297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]