SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015837 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015837
Domain Number 1 Region: 214-312
Classification Level Classification E-value
Superfamily TPR-like 0.0000000173
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000015837
Domain Number - Region: 108-194
Classification Level Classification E-value
Superfamily TPR-like 0.0182
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015837   Gene: ENSPCAG00000016935   Transcript: ENSPCAT00000016924
Sequence length 316
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_296:188515:210756:1 gene:ENSPCAG00000016935 transcript:ENSPCAT00000016924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRASPIRIPTVDDDSDWDSCFRLSQETKIPAQEQTEDLCPTGYSGESXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXNTQANQELIRCFTLSRIIFGEKHWKCAQALVNLAY
GYLTLRGLPAQAKKHAESARSVLLTWKLKTTSNQEKKEIMETLTMLYYTLGVAWLLQNQC
REAYINLKKAERSMKDLKELDKAGICELRVSEKDVTIALGRASLAIHRLNLALTYFEKAI
DGVIAAKGEDTSDLISLYEEIARIEQLRRNHEQAIQYLRQAFSISVSVFSEVSPRTAETS
TLLAKAYAMSGEAQHR
Download sequence
Identical sequences ENSPCAP00000015837 ENSPCAP00000015837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]