SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000016074 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000016074
Domain Number 1 Region: 227-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 164-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 266-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 137-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000016074   Gene: ENSPCAG00000018803   Transcript: ENSPCAT00000018794
Sequence length 325
Comment pep:known_by_projection scaffold:proCap1:scaffold_108699:618:3883:1 gene:ENSPCAG00000018803 transcript:ENSPCAT00000018794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGSGPEVLSQPSDLDPQDLQEVEIGRNTCWPDSESEPEKVLLSPESNGPEEEVGEDSGVL
SSLLRTLPRRRKCGDRFGPEASLDRPAGQPPGEGPWAQKRDAWRLTLLPQGAPGTGAAAA
AAELSSGFGLGRGDRQGKPHRCETCGRSFKYRSLLVKHQRVHTGEKPYACPECGKRFRGW
SGFIQHHRVHTGEKPYECAQCGNAFSHSSHFTQHLRTHNGEKPYKCQSSNLVRHQRLHTG
EKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECGECGRAFRGRSHFFRHLRTHTGEKPF
ACGACGKAFGQSSQLIQHQRVHYRE
Download sequence
Identical sequences ENSPCAP00000016074 ENSPCAP00000016074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]