SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|108241|estExt_fgenesh4_pg.C_1000014 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Volca1|108241|estExt_fgenesh4_pg.C_1000014
Domain Number - Region: 41-98
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0107
Family MgtE N-terminal domain-like 0.017
Further Details:      
 
Domain Number - Region: 86-162
Classification Level Classification E-value
Superfamily X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain 0.0327
Family X-Prolyl dipeptidyl aminopeptidase PepX, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|108241|estExt_fgenesh4_pg.C_1000014
Sequence length 163
Sequence
MHMTGGTPHSRAQHLTLWRVLLGRLDAEALPMCMCAGSSKKYLPKEEVVEVPDFRYIPEP
QLSELVAYMRQRREHLVYHNTTADVRAEIIRNVTEHTQPVDQYPKGRQFLSDEEYMSILR
DLLNLSNILDDMEQTGIVSYTNRTQYYALYSKLYRMLIAKAKQ
Download sequence
Identical sequences D8UJ27
Vocar20013586m|PACid:23132911 jgi|Volca1|108241|estExt_fgenesh4_pg.C_1000014 XP_002958658.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]