SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|59111|e_gw1.13.32.1 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|59111|e_gw1.13.32.1
Domain Number 1 Region: 16-257
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.49e-54
Family PP-loop ATPase 0.0003
Further Details:      
 
Domain Number 2 Region: 237-361
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000000000432
Family MesJ substrate recognition domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|59111|e_gw1.13.32.1
Sequence length 409
Sequence
LWTSLHVKLQQSLTSSNLLGAAESVLVAVSGGQDSVCLLHALVDLRPIWGWRLGVVHCDH
GWRVDSAVNADFVRELAAQHLDLPCYVRAAPQGAVPSERAAREWRYRVFADVAFAHGYDV
VVTGHTATDRAETMLLNLLRGSGPDGLVALARSRPLGSYSPADPTCAPGGELDIPRARSR
SVRLVRPLLEFSRSQTQEFVEQLALPYFHDTTNDCNDLRRNRLRNEVLPALRAGFNPRLD
QALFRFLEVLDADLEYLTRVTEDLYDNVVSYEYRASSGDHSSVPAQGSSDERMLKLHELR
RLPLAMQRRVVRKAGARAGNAPSRVRYEDVARCLALLHAPNRSNSDSLCGGMVASVRDGH
LVLWTPKAAAVEPGWSSSQQQRRQRRAGAAADPELACCTAEVSTAGQGA
Download sequence
Identical sequences D8TSC1
XP_002949175.1.37214 jgi|Volca1|59111|e_gw1.13.32.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]