SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|89049|fgenesh4_pg.C_scaffold_11000072 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Volca1|89049|fgenesh4_pg.C_scaffold_11000072
Domain Number - Region: 20-64
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00157
Family MgtE N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|89049|fgenesh4_pg.C_scaffold_11000072
Sequence length 103
Sequence
MRGAQRSSTESTTSVVWVPEVAAEVAAEVAAEVAAEVAEEVPEEVAAEVAAEVAAEVAAE
VAEEVLGPTVGHRVCCGLSDGRPSYNPYSAMCARAQTYMRTYK
Download sequence
Identical sequences D8TQN4
XP_002948684.1.37214 jgi|Volca1|89049|fgenesh4_pg.C_scaffold_11000072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]