SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|97207|fgenesh4_pg.C_scaffold_58000107 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Volca1|97207|fgenesh4_pg.C_scaffold_58000107
Domain Number - Region: 5-102
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.00288
Family MgtE N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|97207|fgenesh4_pg.C_scaffold_58000107
Sequence length 240
Sequence
MLNWRCVQHRDAELVTELVTELVTELVTELVTELVTELVTELVTELVTELVTELVTELVT
ELVTELVTELVTELVTELVTELGTELGTELGTELGTELGTELGTELGTELGTELGTELGT
ELGTELGTELGTELGTELGTELGTELGTELGTELGTELGTELGTELGTELGTELGTELGT
ELGTELGTELGTELGTELGTELGTELGTELGTELGTEPLAHEPKHVSSGLFRVVARDQQR
Download sequence
Identical sequences D8UC54
jgi|Volca1|97207|fgenesh4_pg.C_scaffold_58000107 XP_002956244.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]