SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|118298|fgenesh5_synt.34__21 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|118298|fgenesh5_synt.34__21
Domain Number 1 Region: 2689-2855
Classification Level Classification E-value
Superfamily Tropomyosin 0.000015
Family Tropomyosin 0.0043
Further Details:      
 
Domain Number 2 Region: 2873-3045
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000314
Family Tropomyosin 0.0037
Further Details:      
 
Weak hits

Sequence:  jgi|Volca1|118298|fgenesh5_synt.34__21
Domain Number - Region: 5541-5740
Classification Level Classification E-value
Superfamily Tropomyosin 0.00141
Family Tropomyosin 0.001
Further Details:      
 
Domain Number - Region: 3201-3422
Classification Level Classification E-value
Superfamily Tropomyosin 0.00719
Family Tropomyosin 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|118298|fgenesh5_synt.34__21
Sequence length 6318
Sequence
MDTSDDLTSLRFGGGEKPAVPLGADELVAYYEKQLAATQLVQHRLQKQCNLLAEEKLALE
TSLSAQTAALQQQLVFAREKAECALAEAEHAQQQVQEARDAVGDIVGAVTHLAELLDISG
ATEELTHSFEAVAHSTQRTFKAVAAAQERSQAVLEVQLEARDACFVSPLLTAASVVSPQG
TDATKRMEEDTVRLRKDLDDAKKREQELEAEMRAAQVLFSALESEVVNLQHDQAQAAAKL
QLSQEELVAARDELRMAHKALLAARSPAASALTQGLAKLDAHLVSVHSFLEGLSMPQPTP
LADALGSTLQLHASRSYDGTTARRPDTFDDGRNSAESGAFPRQQGASTYQQLCALVATAS
GEGPAQALLQGVARKTRLRHQGAEQADMSALTQVPEAPDEGQGAARNHMQRSREDLSQRM
ATLAAERDHLRNRALELESRVTSLETEKEGLLRDRTRQLGMAAAAGAAGAAVAVVVATDA
SSTAPSSPSRPFRVAAPASIVGSESSFTAIAARDAALRRSESLEVEALRDLLRQGAEERG
GAQRLLERLMAVRPVASKQLQYRKPARLARLQTTASSAACSGAADLAVGQYPDVPLVASP
HSPLSRPSPGQTRSRRSYSSIASDSQSVDEAEDVFSGQCEPFHEVSRVYTRSSTALQSSY
ASFASEAPLAPTRRYTEDSQPHTYPLHPTEPLEGLLPAAATRSLLSSGDGGLLREGSRGP
RRSYRTSRAGSDVQSLMAEVDQLQAALCSVLISKAVACTELQAESEQSLAALRAAHDVEL
AKLRGKHSVEVSQLQALLSMSADMSPTPVSQHAAVRSLDKSTCVSEDGLLGGHFGAGMLQ
HTASLDVMMLEIEEHSQQLAPRSKESLQRLKNDHAPQEWESCRQQAWSNQAVGDLTNHEW
AARQKLLDHLQLQCTQHEACIIELREQHAADLMDQQARHSERCLQLQADAVAETAQPTSG
HPDEKCPLVVYEEQLAELRLVVRRLEELRTAERKLADADLIALQEMMAELREKQLSELRE
KVAEKLAEHKVACAALETSQEEVSSERAAAEQLRHKLGACEKELQLRASLISDLQGQLQQ
LQSDKELEEQSLQSLLSTKTWMTEEIRSLQAELKETSSKLAVAEADLAAMKVAKNDRASS
SAGWRLDAATAPSWHRTRDVHATTDALGHGPGGATMASPSRGMGEAQVGSVITMAADQLA
EVAMQAALAEAQFENLHLLQKADVPSDHAVRQPLYKDDVEKTNLMIETVSLQGELDQLQG
KYRTLQAQLEAAADELACAVMRASLAELQRDQLRLERSGAMRSTGAASSRPKQPGRADDT
RFACPPTGVDAAISHGTFTPSKPTDMLLVIDAPDLLGTDAFIPVQQVRQLYRELRTVRRA
LSDVMDTDAVMQCPATSGDEQIAKNAQDGALATGFVHAEIARAHDVYHDTCKVYEMLRSD
AEDINSQLWRWNVQLHKQLCSKENDLTREQQKAIPGPQHAFESLLSRKEAYARSVEGQLS
ELQAALQAAQSRLLHRDGQVAALEHMLVQLSEQITMFEDVVVRCEEVPSVESFDGDVEGA
IEKLKNLICALRSQLKRYRGGHAVSRAAMPAFSSLLAARSQALQTPAATGGLSTVQVALI
AAEREVLSLRSQLSHRQQHIKLLEQRLLEQSQDIAAMCNRGDTLTASPVGSRKASFVERR
FGHGTEVLQPQKAWDFDGLDISGTSGNLADQMRPQLRVQIEEYRTVLAIVAGGQYEQDQN
RLGGAQQRAGEAGGPCRADGSSFSGAGPASPAGGPSSPSLGNARYKEMKRQLDEAAHMLE
GSQDQLLAMQEDADAKEASLQRLNEQLQAMGSSETGRFSASSAAMGDGQTSLPLGHGAST
TVHRNLLFDEEALPGNNQVKELEEIRTERDSAMEQLPLLKRAKRELEARVKELTAEVKLK
DEQLEELQIARQRLDDSTHELNVIAEALEANTQRLAEARAVAGAAGADLEVERRARQQLE
RQIAGSLVAAAKSSPAAEQHHMGRGLASPKGVSSRASSPTRSRAGSPVGSSALATSSGGA
SSVGTHHMSVSQGVDRQADGQVQILSREVTDLLLQLRNAIVANTQAQSNLYEQVQSHSLG
QPVGSPGAGPHLRDPLAALAEAQERVKALSDASVQAREELCAVSAARDAALAHAAELLAK
NQQAQAEVERLSVACVEARTQETGLKRRLANVNEEAELKLVTLEAAKEQLLGQLRKADER
AHTLQVQIEEKASALLTLSLAHAGDQVKITSLEASLAAARSINNSLWSQLEAVANKVGMD
TYPAAPGSLKGRWSYSGLPSTAAAHSSSESHVGNMARTLGTVTRSPDLQEVPSEACQVHR
GLQLLQPEYATEDDSSAPVIPSDEVASPYKRSETDDGVRFTAVPDVATAVQSYMDSLHLD
ASAVRTQLEAELREARGQIAAALQEVAELGARGASLQVHDRPHVESDGHRVEGRHNLYSS
NEIAGTAIPCGLQAPQPEAERSINMADVRILTAAKAALQQQYEDAEAGRAMAEQQLAQAL
NEIRELQRRVSAAKEMPVLMHQEMAEIKASHDEQQFEEAETRRMAVQAELDEADRDYPAG
LVALEVANSAQRQHDKDSPAGRVMVEQLLAEAVNEIAELKRRVAVGEAPAQHQIAEVETS
RAKFQKQFEEAEMGRMSLLAELDEARRDLSAAVAGREAKEALQRQYDDAVASRALAEQQL
LDARAEIEELERRVTAADEKEALVLRRVQDVETSRAELQQQLRGAEASRSALQAELDEAW
RAHSTALAGLEGAKEALKRQFHDAVASRGTAEQQLAEARAKIDELESRVSAAEEKEALMQ
RQVEATETSRGKLQQQLEDSEARRVSLHAKLADADRAYSAGMADLEVSSAANRQQSENAD
ASRVIAEQRLAEACTKVEELQRRVSAAGEKEALVQCRVQEMETSRAELQQQLRGAEASCK
ALQAELDEAWRAHSTALAGLEGAKEALKRQYEDAVASRVMAEQQLAEARAEIEELECRVS
AVEETVVLSQQRAGAIEASRAELQQQLEEKETSRNALQIELDKALLVHSTAVADMEAAKK
ALQQQLEDAEAGRVMAEQQLAEARAIIVDLQKRVSAAQEAASSAQQQLGEVEASRSAAQQ
QLLGLQLQLSAKEVELKGLIERIGALNQQISSICSLVEGYHCIDARPLAAAATTLSLPGN
FDSSRPLNEDVVASVAGMRASLERRLDAVGQEASAQAARAAELEARLAEAQILVAKLEGL
LLTSDAELRAATDRVKELEELLLGKEAKLQEQEVERQAIAQELETSQQRFAEFQVNVEGV
RGSAEIVSAQLDEYKAISRQECAIAEQARDEAIATATAAREELESLHEALMASNAETEAY
RARVAAVEMELFKVEEHVDSLQRGIRDSESQIGELRAELAAAQMDLAAARDERDDAMRLL
DGAREEACLRSDEHQQQLDRFRQELEAAGMQQESLARQSAEAIAEKNAASVRADANLEAV
RRQLVELQTKLTETQAELLDTVKKLADAHVQLQAACCERDSAKARLLEAQAGKQGELLGA
VKELAEARKQLQAAVSERDAAAAKLMEAQAEKQAELLHAKSELAEGREQLRDALRERDIT
ATKHMKALAEKEAELLHVMAELAETQEHMRSALTERDAAKAMQTEIQAEKHADLLRVTAE
LAHAREHLQGAMSERDAAAAKQAEVLAKQQAELQHVKSELAEAREQLRTALSERGTAEAA
QAKVREELLHATAELHAAHEHLKAAMLERETAAAKQAEIEAEKLGELLQVKLELAEARDR
LKAALSERDTAVDMRAELHAEKEAELLRVTAELAEAREHMRGAMMERDAAAAKAEGVLSE
RNAELLHVKAELSEARGHLRAAVVERDAMAAKMVEALAEKHAELLSVKAELMEAHEQVRI
ALAERDAAVAKQADTRAEKQAELLRVTAELAQAREHLQEAMSEREIAGSKQAALQAEKDA
ELLQLRSDLAEASRQVRAAISERDAAMGKQVEVQAEKQAELLRVLAELAEAREHLRTALT
ERDSVAAKMVEALAEKQAELLHANAEIVQLHEQVARQAEVQAEKEAELLRVTAEFAEAQD
LAAVQQVELAHATAELVEAREQVQVALSERNTLVAKQAEALAEIQAELLDAKTELADTRE
HLQAAISERDAVAAKHAGNLAETQAQLSHAMSELVAAQEELRAAVAEHDTSAVKMAEILA
EKQAELLHVTAELAEAREQLRATVSERDAAAAETAEAQAEKQTELLRIGTELAEAREQLR
TALAERDAATARQAELQAEKQAELLRVLAELTEAREQQRKALLERDAVAAKQAEVQAETQ
AELLHVTDELAEAREHLRAAMLECDAAAAQQTEVLAEKEAHLQHIMAELAQAREHLQTTA
AERDATASKMAEVLGGNVAELLRVKVELTELREHLRTTMLEHDAANTKHAEVQAEKQAEL
LHAKSELAKAQEHLGAALTERDAEAAKHAEAQAEKHAELLHATAELAKLRQHLGTVLAER
DAIAKQAEVVAEKQEELLRATAENAQTQEYMQTALAERDAAAAKQAEILEEKQAELLRVT
SQLAEAREQLRAALAECSTATAKQGEILAEKQADLLRFTAELAQAREQLRAALAERDIVA
AKRAEVEADKQAELLCVTAQLAEAREHLRAALTEHDAATAKQVEVLAEKQAELLHVRAEL
AHARDQLRVTIAERDAAAAKQAEVRESRHADLLRATTELAEAREQLRAAISERDAVAAKQ
AEVLAGKQAELLNMTTDLAQTRGQLHAALSERDNALVKQAEAATRLSLAREAADAKRAEH
EATVKLLETALAAKDTACSDLSSLRSELLTAVKMLSDAQAERDTAVRQLEDLRVEVRGLQ
SEVPMLAKHLIEAQEQSQDACNQHEAATARLLELEAQLVATGQLLASAHEAIESRRAEHA
VAMERLDTVLADKDKMSTDLAEARSQVLTALNELSEARAQRDAALQQLNAVRDVLTAIED
ERSSSAAAAAVTAAVMREQQRTVEAQQRNLDASRASEAARVAQHLRALELRADDLTQHAE
DLQRRLNAAEAHLSSERAEAQVVRARLELHLASTRTELEATAAERTAALQQLAAAHAELV
EVTGRCADLEDKIVTVEQLCELVKSQLDATKQQLLEAEDRAAADRIGAETAQAKAEELQG
KLRADLAAAHAELVAVAAQRDALDAQLAVLLPTLSAAQAEHAAGVRQLKNLKGDQALLES
QLGPLEEHAKVLEQQAENLRQQLVMTEARHVAEKAETQNAIARLEAHLEAVRADLAASTT
ARDVSAQQLAQLRLENHELHAEHLQHQIGKLQEQLTGAEVRLAAERNEVHSARMQAAAVR
SELAAVMTERDTVSSQAAALRTELASIRSEHESAAQQHALTLQAKASLEEQVKSHQHEIV
QLEKQLERKARLREQLTDADAKLRAERESHTATQGLLAAAKAEVSQVHGELAALRKELTT
ATKELAAQHTLTESRIGEMQVKVAQARAQASEESDKVQRLKAELLEVAKARQDAERQLVD
RDVDAKGIAAGLEAALEATRATLEAERARGEQKAKAAQQASVAAQQRVLLLDSQLSTARA
AESDAQRALAEARQNIGKQEAEAASRIMSLEADLAAAKEAIASLEDHQKHAVEASRNAEE
ELRLERERMSQLEPRLAMLADEVAALQAELANARSALHRYEAYAVDAEAEIQELRTAAEV
SSAENLRLQQQLDHLVDQLRRQTQQLRAAEADTAHLREEVAAMNIMGTAARRSGSSISHG
RSGERRHGSAGRTAVAGGRPSSGSASILEDQLNHSQQQMLILRKPHHGSRHPSPAIASAA
SAVNNPVSRTGEDQAGRPARPRASSVEPRPLPVATAQERHSGDATADTRSMSPTSLLQKR
LTDEATQLRWEVVADSSRVRELQEKRAGGVYLTRAEVSEMELLTARLGAHHARISAIMDT
AVSPAGRGMGLSPGGKLLESPSRMRFFDLETRAEPAELPRAAASRTDNQPPSRREVLDSR
DETGALSNTAKYAREMRRPGEATPNRPASSLHVGMEYGDGNSPAQVQSGSDSVSPQTLGL
IYRSFPSPSNQSVRSTVAIINVSPWYPPGPTPGRVISPVRAASPANLAGRAVISAVDTRG
NFGGRSAGTTPVRERTCEGAHEPRTVETDEAVGIASSVLSVVGGEALGVGPGGPGAGVGG
APRAATRYRTPYLRMLQDMVMLGVGGGVGGRGGGASGTARRTGSGGNEATRPSNGVMNAA
APQHPGSGDAGHDTLAHWGSGGGADGSQGVLSLQASAGASHSRGPSPCREHVNRLAYMPT
DMGAASPLNGLGNGSSYM
Download sequence
Identical sequences D8U3I3
XP_002953162.1.37214 jgi|Volca1|118298|fgenesh5_synt.34__21

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]