SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|80808|estExt_Genewise1Plus.C_150260 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|80808|estExt_Genewise1Plus.C_150260
Domain Number 1 Region: 210-325,420-439
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000000802
Family CBS-domain pair 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|80808|estExt_Genewise1Plus.C_150260
Sequence length 467
Sequence
MYILRRGLLGGEDPPDSSGSAQEDEFLFTLYICIALFLVLMAGLMSGLTLGLMSLDTVEL
EVLKRSGTPEERACAIKIMPVIKHQHFLLVTLLLCNAAATEALPLFIDRLADPVTAVILS
VSVVLVFGEIIPQAVCSRYGLKVGAYSAWFVRILMTICSPIAWPIGKLLDFMLGPDHSAL
FRRAQLKALVDLHGTGAGFGGTLSEDEVHVIRGALDLTNKVACKSMTPLDKVFMLSTADR
LDEGTLRAILLSGHSRIPVHREGNRKVITGLILVKELVLINPADNVPVSSLRLRELPRLA
ADTPMYDMLKLFETGKSHMAVLTRAPGGGPLSPHHPATHQGGGGSEVDLAHGASVQGGRK
PVGASWQTHPRGAPSRRLGSATATNSMYGSHSRDGYSALTEDVGPGGGGGGGGGGGGGGQ
EGEPVGIITIEDVIEELLQEEIIDETDLFIDNLQSQRVNAAAVAGSL
Download sequence
Identical sequences D8TTP8
jgi|Volca1|80808|estExt_Genewise1Plus.C_150260 XP_002949793.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]