SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28898866|ref|NP_798471.1| from Vibrio parahaemolyticus RIMD 2210633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28898866|ref|NP_798471.1|
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 2.75e-55
Family Molybdopterin synthase subunit MoaE 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28898866|ref|NP_798471.1|
Sequence length 151
Comment molybdenum cofactor biosynthesis protein E [Vibrio parahaemolyticus RIMD 2210633]
Sequence
MDPRVSVQVEDFSVDQEYQRLSEGTASGAVVTFIGKVRDMNLGDNVIGLHLEHYPGMTEK
SLSDICDEAEARWPLLGVRVIHRVGDMDSGDQIVFVGVSSAHRGAAFDACEFIMDYLKTK
APFWKKERTTNEDRWIESRDTDHQAARRWEK
Download sequence
Identical sequences A0A0F6LV54 A0A0L8S6H5 Q87MY4 Z2EWI7
gi|28898866|ref|NP_798471.1| 223926.VP2092 NP_798471.1.6614 WP_005490611.1.101585 WP_005490611.1.10999 WP_005490611.1.14243 WP_005490611.1.15211 WP_005490611.1.15563 WP_005490611.1.16503 WP_005490611.1.16742 WP_005490611.1.1836 WP_005490611.1.19074 WP_005490611.1.19755 WP_005490611.1.20587 WP_005490611.1.21130 WP_005490611.1.22008 WP_005490611.1.22854 WP_005490611.1.22951 WP_005490611.1.24866 WP_005490611.1.25390 WP_005490611.1.26080 WP_005490611.1.26245 WP_005490611.1.264 WP_005490611.1.26729 WP_005490611.1.27000 WP_005490611.1.29928 WP_005490611.1.31998 WP_005490611.1.35351 WP_005490611.1.35596 WP_005490611.1.35751 WP_005490611.1.36788 WP_005490611.1.37148 WP_005490611.1.37683 WP_005490611.1.39 WP_005490611.1.39142 WP_005490611.1.39379 WP_005490611.1.3961 WP_005490611.1.39756 WP_005490611.1.39842 WP_005490611.1.42776 WP_005490611.1.42858 WP_005490611.1.43185 WP_005490611.1.43895 WP_005490611.1.45633 WP_005490611.1.46057 WP_005490611.1.4734 WP_005490611.1.47510 WP_005490611.1.48035 WP_005490611.1.4861 WP_005490611.1.48612 WP_005490611.1.4902 WP_005490611.1.49432 WP_005490611.1.49920 WP_005490611.1.50640 WP_005490611.1.50833 WP_005490611.1.51945 WP_005490611.1.52959 WP_005490611.1.53064 WP_005490611.1.53943 WP_005490611.1.54059 WP_005490611.1.55108 WP_005490611.1.55354 WP_005490611.1.5595 WP_005490611.1.56068 WP_005490611.1.56836 WP_005490611.1.56842 WP_005490611.1.57129 WP_005490611.1.57332 WP_005490611.1.5768 WP_005490611.1.58791 WP_005490611.1.5962 WP_005490611.1.59887 WP_005490611.1.60089 WP_005490611.1.61129 WP_005490611.1.61745 WP_005490611.1.62401 WP_005490611.1.6274 WP_005490611.1.6404 WP_005490611.1.65279 WP_005490611.1.66850 WP_005490611.1.71278 WP_005490611.1.71997 WP_005490611.1.73712 WP_005490611.1.74603 WP_005490611.1.75461 WP_005490611.1.79694 WP_005490611.1.81752 WP_005490611.1.81782 WP_005490611.1.81805 WP_005490611.1.81887 WP_005490611.1.82387 WP_005490611.1.82791 WP_005490611.1.8373 WP_005490611.1.84036 WP_005490611.1.86416 WP_005490611.1.86700 WP_005490611.1.88312 WP_005490611.1.90588 WP_005490611.1.91910 WP_005490611.1.92596 WP_005490611.1.92816 WP_005490611.1.93458 WP_005490611.1.96237 WP_005490611.1.96264 WP_005490611.1.9642 WP_005490611.1.96491 WP_005490611.1.99805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]