SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003580 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003580
Domain Number 1 Region: 140-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-53
Family C-terminal domain of adrenodoxin reductase-like 0.00000000388
Further Details:      
 
Domain Number 2 Region: 59-193,383-420
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000126
Family C-terminal domain of adrenodoxin reductase-like 0.00000385
Further Details:      
 
Domain Number 3 Region: 373-496
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000324
Family N-terminal domain of adrenodoxin reductase-like 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003580   Gene: ENSPVAG00000003782   Transcript: ENSPVAT00000003783
Sequence length 497
Comment pep:known_by_projection scaffold:pteVam1:scaffold_17590:14254:23147:-1 gene:ENSPVAG00000003782 transcript:ENSPVAT00000003783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWRCWHWSVWPRTRPPPARSTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLKH
ARAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTAHSDRCAFYGSVVVGRDVTVP
ELREAYHAVVLSYGAESHQALEIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTAV
ILGQGNVALDVARILLTPPEHLEVFLLCQKTDITEAALGVLRRSQVKTVWIVGRRGPLQV
AFTIKELREMIQLPGTRPILDPADFSGLQDRIKEAPRPRKRLMELLLRTATEKPGAQEAA
RQALASRAWGLRFFRSPQQVLPSPDGQQVAGIRLAITRLEGVGEATRAVPTGDTEDLPCG
LVLSSVGYKSRPIDPSVPFDPKLGIIPNVEGRVVDVPGLYCSGWVKRGPTGVIATTMTDS
FHTSQTLLQDLKAGLLPSGPRPGYSAVEALLRSRGVRPVSFSDWEKLDAEEVSRGQGAGK
PREKLLDPQEMLRLLGR
Download sequence
Identical sequences ENSPVAP00000003580 ENSPVAP00000003580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]