SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016881 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016881
Domain Number 1 Region: 27-269
Classification Level Classification E-value
Superfamily CutC-like 5.36e-81
Family CutC-like 0.00000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016881   Gene: ENSPVAG00000017895   Transcript: ENSPVAT00000017895
Sequence length 273
Comment pep:known_by_projection scaffold:pteVam1:scaffold_3156:119208:139911:1 gene:ENSPVAG00000017895 transcript:ENSPVAT00000017895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQRASSERKRARIPSRKAGAANGFLMEVCVDSVESAINAERGGADRIELCSSLLEGGT
TPSMGVLQVVKQCVQIPIFVMIRPRGGDFLYSDREVEVMKADIHLAKLYGADGLVFGALT
EDGHIDKELCMSLVALCRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDGSALE
GLPLIKRLIDQAKGRIVVMPGGGITDRNLQRILEGSGAAEFHCSARSARDSGMKFRNSSV
VMGASLSSSEYSIKVTDVTQVRTLTAIAKNILV
Download sequence
Identical sequences ENSPVAP00000016881 ENSPVAP00000016881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]