SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000463 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000463
Domain Number 1 Region: 242-511
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-84
Family Eukaryotic proteases 0.0000000109
Further Details:      
 
Domain Number 2 Region: 159-262
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000144
Family Hepsin, N-terminal domain 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000463   Gene: ENSPVAG00000000493   Transcript: ENSPVAT00000000493
Sequence length 523
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_514:44762:60207:1 gene:ENSPVAG00000000493 transcript:ENSPVAT00000000493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQACSLLPWTQTFSPPLRAQAWEPPALRVYPCHWSDTDPILEPNPICIRDHSVLWPGPSS
SSLPGWAPGTRGTGLGWAPPGPASPSISPQALPRPRRSAGESLTRGRDMAEKEGGRTVPC
CSGPKVAALTAGTLLLLTGIGAASWAIVTVLLRSDQEPLYLVQVSPADARLTVFDETEGT
WRLLCSSRSNARVAGLSCEEMGFLRALAHSELDVRTAGANGTSGFFCVDEGRLPHARRLL
DVISVCDCPRRSAIICQDCGRRKLPVDRIVGGQDTSLGRWPWQVSLRYDGAHLCGGSLLS
GDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVIYHGGYLPFRDPNSEEN
SNDIALVHLSSSLPFTEYIQSVCLPAAGQALVDGKICTVTGWGNTQYYGQQAGVLQEARV
PIISNDVCNGPDFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDNISRTPRWRLCGI
VSWGTGCALARKPGVYTKVGDFREWIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences ENSPVAP00000000463 ENSPVAP00000000463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]