SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001496 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001496
Domain Number 1 Region: 336-566
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-50
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 2 Region: 637-887
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-49
Family YWTD domain 0.00000893
Further Details:      
 
Domain Number 3 Region: 934-1193
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-37
Family YWTD domain 0.0000706
Further Details:      
 
Domain Number 4 Region: 157-286
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-29
Family YWTD domain 0.0000829
Further Details:      
 
Domain Number 5 Region: 1322-1358
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000011
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 890-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000431
Family EGF-type module 0.027
Further Details:      
 
Domain Number 7 Region: 1284-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 8 Region: 1244-1282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 9 Region: 592-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000412
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 10 Region: 291-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 1201-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001496   Gene: ENSPVAG00000001586   Transcript: ENSPVAT00000001587
Sequence length 1602
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2554:22264:135331:1 gene:ENSPVAG00000001586 transcript:ENSPVAT00000001587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAPARPPLLLLALCCSLAPAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYMYWTDWGETPRIERAGMDGSTRK
VIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSG
DTLYWTDWQTRSIHACNKRTGEKRREILGALYSPMDIQVLSPERQPYFHTQCEEDNGGCS
HLCLLSPREPFYTCACPTGVQLQDNGKTCKAAEEVLLLARRTDLRRISLDTPDFTDIVMQ
VDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVAR
NLYWTDTGTDRIEVARLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECAD
LDGQERHVLVNTSLGWPNGLALDLQEGKVYWGDAKTDKIEVINVDGTKRRTLLEDKLPHI
FGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCADR
NGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIVPEAFLVFTSRAAIHRISLETSSNDVA
IPLTGVKEASALDFDVSSGHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMGKNLY
WADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDG
TNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQGRVVIADDLPHPFGLTQ
YSDYIYWTDWNLHSIERADKTSGRNRTLVQGHLDFVMDLLVFHASRQDGLNDCVHSNGQC
GQLCLAIPGGRRCSCASHYTLDPSGRNCSPPSTFLLFSQKSAISRMIPDDQHSPDLMLPL
HGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPSILTSPSPNQNPDRQPHDLSIDV
YSRTLFWTCEATNTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQEPAAKI
ERTALDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDAN
VVQPVGLAVLGRHLYWIDRQQQMIERVEKTSGDKRTRVQGRVAHLTGIHAVEDVSLEEFS
AHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDC
IPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCD
AICLPSQFRCASGQCVLIKQQCDSFPDCVDGSDELMCEISKPPSDDTPAHSSAIGPVIGI
ILSLFVMGGVYFVCQRVVCQRYTGASGPFPHEYVSGTPHVPLNFIAPGASQHGPFTGISC
GKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNV
DTFYSSSVPAPARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPY
PPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSPVAP00000001496 ENSPVAP00000001496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]