SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003336 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003336
Domain Number 1 Region: 216-508
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.31e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 24-233
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 8.5e-55
Family Cryptochrome/photolyase, N-terminal domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003336   Gene: ENSPVAG00000003527   Transcript: ENSPVAT00000003527
Sequence length 593
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3945:137422:159932:1 gene:ENSPVAG00000003527 transcript:ENSPVAT00000003527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATVGTAAAAASAPAAGTDGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWF
AASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPTDVFPRLFKEWGVTRLTFEYD
SEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRME
LPKKPVGSVTSQHMESCTAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARL
DKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNST
PPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWID
AIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESIQKAAKCI
IGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLNNPVAEPSSSQ
TGSMNNAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPAPELPSRDV
Download sequence
Identical sequences ENSPVAP00000003336 ENSPVAP00000003336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]