SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003365 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003365
Domain Number 1 Region: 249-485
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-86
Family Eukaryotic proteases 0.0000481
Further Details:      
 
Domain Number 2 Region: 159-255
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-18
Family Hepsin, N-terminal domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000003365
Domain Number - Region: 138-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000157
Family LDL receptor-like module 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003365   Gene: ENSPVAG00000003559   Transcript: ENSPVAT00000003561
Sequence length 493
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3243:419250:443919:-1 gene:ENSPVAG00000003559 transcript:ENSPVAT00000003561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDGRPNASPARMSPARTAPARASPPRSSSARSSSTRSSSARSASTTSSPTRVYLVRAT
PVGAVPVRASPATSAPATRATNESSNVSLPKFTWQQGQKRLPLIGCILLLIALVASLIIL
FHFWRGHTRIKYKEPVESCPMHSVRCDGVADCKLKSDELGCVRFDWDKSLLKVYSGSSHQ
WNPVCSDSWNNSYSVKTCQQLGFESAYRTTEVAHRDFASSFSISEYNSTIQKSLYRSECP
SQRYISLQCSHCGLRAMTGRIVGGALAPESKWPWQVSLHYGITHICGGTLIDAQWVLTAA
HCFFVPGELEGVYATNNQLEASISQIIINGNYTDEQDDYDIALIRLSKPLTLSAHIHPAC
LPMHGQTFNLNETCWITGFGKTRETDEKTSPFLREVQVNLIDFRKCNGYLVYDSYLTPRM
MCAGDLQGGRDSCQGDSGGPLVCEQNKRWYLAGVTSWGTGCGQRNKPGVYTKVTELLPWI
YSKMENEVHFRKS
Download sequence
Identical sequences ENSPVAP00000003365 ENSPVAP00000003365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]