SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003554 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003554
Domain Number 1 Region: 325-427
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.68e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 54-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 136-190,217-232,260-278
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000168
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003554   Gene: ENSPVAG00000003755   Transcript: ENSPVAT00000003755
Sequence length 706
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3088:27007:88103:1 gene:ENSPVAG00000003755 transcript:ENSPVAT00000003755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDMPGSVTLPVAPMAATGQVRMPGAVPARGGKRRSGMDFDDEDGEGPSKFSRENHSEI
ERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPS
FLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDD
VEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGSAPLDHV
PLNRISTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVGQGSKYCL
VAIGRLQVTSSPVCMDMSGMSVPTEFLSRHSSDAVITFVDPRCISVIGYQPQDLLGKDIL
EFCHSEDQSHLRESFQQVVKLKGQVLSVMYRFRTKSREWLLIRTSSFTFQNPYSDEIEYV
ICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHESGKSVEKADAIFSQER
DPRFAEMFAGISASEKKMMSSASTAGTQQIYPQGSPFPAGHSGKAFSSPVVHVPGVNDMQ
SPSPAGQSMSQISRQLSQSQAAWAGSRPPFPGQQIPSQSSKTQSTPFGIGTSHTYPADPS
SYSPLSSPATSSPSGNAYSSLASRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQSGE
QHAHQQPGQTEVFQDMLPMPGDPTQGTANYNIEDFADLGMFPPFSE
Download sequence
Identical sequences ENSPVAP00000003554 ENSPVAP00000003554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]