SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004927 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004927
Domain Number 1 Region: 764-899,958-1024
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.98e-40
Family Hemopexin-like domain 0.0008
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000129
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 27-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000732
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004927   Gene: ENSPVAG00000005206   Transcript: ENSPVAT00000005206
Sequence length 1024
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1091:34869:49438:1 gene:ENSPVAG00000005206 transcript:ENSPVAT00000005206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKTLPIYLLPLLSLFLIQQVSSQDLPSCAGRCGEGYSRDAPCNCDYNCQHYMECCPDF
KKVCTVELSCKGRCFESFARGRECDCDAQCMKYGKCCSDYEDFCAKVHNPTSPPSSKTAP
PPADASQVIKSTTKRSPKSTNKKKTKKVVESEEIMEEHSVSENQESSSSSSSSSTIRKFK
SSKNSAANRELKKKPKVNDNKKKQTPKKKPTPEPAVVDEDGSGQDTGDVKITPTPDSPTT
QSNKVTTTSETTTTVTTTNSKPSLPSKSETTKETTSTVNKETTVETKETSVTKKQTSASA
TEKTISAKETRSAEKTTATSEGPAKSTSEAETTTAPTTPPKSAPTTTKGPAPTTPKEPVP
TTTKGPAPTTTKGPAPTTTKGPAPTTTKGPAPTTTKGPAPTTPKEPAPTTPKEPAPTTPK
EPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKDPTPTSPETPVPTTSEASTPATTMEPPI
PTKNPDASTPEFPAKPTPKALENSPKELAVSTTKTTITSEVTKPAMTTTAKDKTTEKSTH
TTTKITTTASESTTKETATPTEEKTTESKMTSTTVQATSTTAKDSTTSSEVAHKETTVAP
KVMTATKKTTTTTEETMDTSEVTTATAKDTATTSKVTTTDLPNPTEAPQILTSTKKPNTT
PKVRQPKPTPSPPKMTSSTVPTPNSAPSGEGILQTTTGPNQAPNSETVEENPKNEGEDAD
EGEEPPIILRPHVLTPIVIPGSDFIVRGPSQGMDFNPMLSDETNICNGKPLDGLTTLRNG
TLVAFRGHYFWMLNPFSPPSPPRRITDVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFT
NDRQDPGYPKQIVKGFGGLNGKIVAALSIAKYKDRPESVYFFKRGGRIQQYTYKQEPTRK
CTGRRPAINYPVYGEVTQVRRRRFERAIGPAQVQAIRIQYKPVRVLYQDKGFLHNEVKVS
SLWRGLPRVVTSAIALPNLRKPDGYDYYAFSKDQYYNVDVPSRTARAITTRSGQTLSKVW
YNCP
Download sequence
Identical sequences ENSPVAP00000004927 ENSPVAP00000004927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]