SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005915 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005915
Domain Number 1 Region: 612-867
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 311-549
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-49
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 2-260
Classification Level Classification E-value
Superfamily YWTD domain 7.19e-45
Family YWTD domain 0.00000353
Further Details:      
 
Domain Number 4 Region: 869-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 915-1056,1111-1158
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000017
Family YWTD domain 0.0012
Further Details:      
 
Domain Number 6 Region: 1301-1339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 567-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1222-1262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000127
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1263-1299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 263-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000718
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 11 Region: 1179-1233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000325
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005915   Gene: ENSPVAG00000006250   Transcript: ENSPVAT00000006256
Sequence length 1589
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1219:117138:179289:-1 gene:ENSPVAG00000006250 transcript:ENSPVAT00000006256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFGHGLIYWSDVSEEAIKRTE
FNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGLRKVLXXXXXXXX
XXXXXXXXXXFMYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLDYEEQKLYWAD
AKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLRE
IHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENG
KTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDE
VRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKIL
ISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYD
EGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHK
RSAEREIIIDQLSDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFEL
ISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTD
ISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQ
VLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDY
AKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANK
TSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHY
SLNSDNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVXXIDYDPLDKHCM
DSRQNVIRKAQEDSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRL
DGRSIGVVLKGEQDRPRAIVVNPEKGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXANRIVLEDSNILQPVGLTVFENWLYWIDKQ
QQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELLHEYRQHPCAQDNGGCSHICLVKGDG
TTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELN
CPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKK
CDHNVDCSDKSDEVECYPTEEPTPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKG
DGETMTNDYVVHGPASVPLGYVPHPGSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAH
VTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRH
FAPPTTPCSTDVCDSDYAPSQRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENY
ESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSPVAP00000005915 ENSPVAP00000005915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]