SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009397 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009397
Domain Number 1 Region: 248-340
Classification Level Classification E-value
Superfamily TAFH domain-like 1.83e-33
Family TAFH domain-like 0.0000293
Further Details:      
 
Domain Number 2 Region: 647-694
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000157
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009397   Gene: ENSPVAG00000009968   Transcript: ENSPVAT00000009969
Sequence length 857
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1881:114989:221739:1 gene:ENSPVAG00000009968 transcript:ENSPVAT00000009969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAASPAGVSASGTLTMAPAGALPIRVESTPVPLGAVTKAPVSVCVEPTVSQ
PLRSPVGTLVTKVAPVSALPKLSSGPVLPAPQIVAVKAPNTTIQLPALQLPPGTVLIKSN
SGQLMLVSPQQAVTRGETTSNITSRPAVQTNTQTVKICTMPNSNSQLIKKVAVAPVKKLT
QIGTTVVTTVPKPSSVQSVPTSVVTVTPVKPLNTVTTLKPSSLGVSPTSPNEPSLKAENS
AAAQTNLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEAEEFT
RQLYVELKSSPQPHLVPFLKKSVSALRQLMPNSQSFIQQCLQQTSNEVVIATCTTPVTTS
SVVTTVSSIQSEKPIIVSGATTPRTVSVQTLNPLADPGGAKTGVVTLHSVGPAAVPGGTA
GTVLLQTPKPLVTSVQNTVTAVSLQPEKPVVSGAAVTLALPSVTFGETSAAAICFPPVKP
VVTSAGTSDKPVIGAPVQIKLAQPGSILSQPAGIPQAVKVKQLXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSILKQITLPGNKILSLQGSSIQKNKIQENGT
ASFRDEDDINDVTSMAGVSLNEENACILATNSELVGTLIQSCKDEPFLFIGALQKRILDI
GKKHDITELNSDAVNLISHATQERLRGLLEKLTAIAQHRMTTYKTSENYILSSDTRSQLK
FLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQLELAQIQHRDAN
LTALAAIGPRKKRPLESGSGNEGLKDNLYASGTSSLTATKPLLRPRITRICLRDLIFCME
QEREMKYSRALYLALLK
Download sequence
Identical sequences ENSPVAP00000009397 ENSPVAP00000009397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]