SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010283 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010283
Domain Number 1 Region: 206-449
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-73
Family Eukaryotic proteases 0.00024
Further Details:      
 
Domain Number 2 Region: 110-213
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-17
Family Hepsin, N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010283   Gene: ENSPVAG00000010911   Transcript: ENSPVAT00000010911
Sequence length 451
Comment pep:known_by_projection scaffold:pteVam1:scaffold_19381:2486:14163:1 gene:ENSPVAG00000010911 transcript:ENSPVAT00000010911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPMLDGQAPTEAQYAEEGPGPWIFRAELGDQQQPISLAGCWCSRRRGCAVLAALGLLAG
ASVGSWLLALHLWPAASQPISGALQDEAMTLSCSEANGEEALLPSLPKTVSFRINTEDFL
LQVQLRAQPDWVLVCHEGWSSALGVQICRSLGHLSLIHQKGVNLSDIKLNSSHKFAQLPP
KLGGVLEEVWQPRDNCASGQIVSLKCSECGARPLASRIVGGQAVAPGRWPWQASVALGSR
HTCGGSVLAPHWVVTAAHCMHSFRLSRLSSWRVHAGLVSHSMVRPHQGTVVERIIPHPLY
SAQNHDYDVALLRLRTPLMFSXXXXXXXXXXXXXXFPKGSQCVSGSHTDPSHTHSSDTLQ
DTVVPLLSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGGTWRLVGV
VSWGRGCAEPNHPGVYAKIAEFLDWIHNTAW
Download sequence
Identical sequences ENSPVAP00000010283 ENSPVAP00000010283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]