SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010571 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010571
Domain Number 1 Region: 434-827
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.53e-132
Family Ankyrin repeat 0.000000000184
Further Details:      
 
Domain Number 2 Region: 212-452
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.1e-70
Family Ankyrin repeat 0.0000033
Further Details:      
 
Domain Number 3 Region: 44-168
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-37
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 4 Region: 4082-4191
Classification Level Classification E-value
Superfamily DEATH domain 1.85e-22
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010571   Gene: ENSPVAG00000011214   Transcript: ENSPVAT00000011215
Sequence length 4375
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2208:66570:346218:-1 gene:ENSPVAG00000011214 transcript:ENSPVAT00000011215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHAASQLKKNRDLEINAEEETEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDDTKAAALLLQNDSNADVESKSGFTPLH
IAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRD
GLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPV
DDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL
KHGASIQAVTESGLTPIHVAAFMGHVSIVSQLMHHGASPNTTNVRGETALHMAARSGQAE
VVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSA
REGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDASGKSGLT
PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAV
TRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
AHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVDAKTKNGYTPLHQAAQQGHTHIIN
VLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEETITTTTVTEKHKMNVPETM
NEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDAMTGDTDKYLGPQDLKELGDDSLPAE
GYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSL
RHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRI
TCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVL
RSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRI
KQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKVLGNKATFS
PIVTVEPRRRKFHKPITMTIPVPPPSGEVSNGYKGDTTPNLRLLCSITGGTSPAQWEDIT
GTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMN
DPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQ
QLVFNFYAFKENRLPFSIKIRDTSQEPCGRLSFLKPKTTKGLPQTAVCNLNITLPAHKKE
TESDQDDETEKADRRQSFASLALRKRYSYLTEPGMIERSAGATRSLPTSYSYKPFFSTRP
FQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSVK
SVSDVASPIRSFRTISSPIKTVASQSPYNIQVSSGSLVRAPTVTEASSPLKGLASNSAFP
SRTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLPFKSIITSAAPLISSPLKSVVSP
AKSAVDVISSAKVTMASSLSSPVKQIPGHAEVALVNGSISPLKYPSSSTLINGCKATASL
QEKISTATNSVSSVVNAATDTVEKVFSTTTAMPFSPLRSYVSSAPSAFQSLRTPSASALY
TSLGSSISATTSSVTSSIITVPVYSVVNVLPEPALKKLPDSNSLTKSAAALLSPIKTLTT
ETRPQPQFSRTSSPVKSSLFLAPSALKLSTPSSLSSSQEILKDVAEMKEDLMRMTAILQT
DVPEEKPFQPELPKEGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVDNKRPPKSPKSDK
GHSPEDDWIEFSSEEIREARQQASASHSPSLPERVQVKAKAASEKDYNLTKVIDYLTNDI
GSSSLTNLKYKFEDAKKDGEERQKRILKPAIALQEHKLKMPPASMRPSTSEKELCKMADS
FFGTDTILESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPV
ITETRTEVVHVIRSYEPSAGDASQSQPEEPMSPKPSPTFTELEPKPPTSSIKEKVKAFQM
KANSEEEDHNRALSKGMRVKEETHITTTTRMVYHSPPGSEGTSERIEETMSVHDIMKAFQ
SGRDPSKELAGLFEHKSAVSPDVHKSAAETSAQHAEKDNQMKPKLERIIEVHIEKGNQAE
PTEVIIRETKKHPEKEMYVYQKDLSRGDINLKDFLPEKHDAFPCSEEQGQQEEEELTAEE
SLPSYLESSRVNTPVSQEEDSRPSSAQLISDDSYKTLKLLSQHSIEYHDDELSELRGESY
RFAEKMLLSEKLDVSHSDTEESVTDHAGTPSSELQGSDKRSREKVVTAPKKEILSKIYKD
VSENGVGKVSKDEHFDKVTVLHYSGDVSSPKHAMWMRFTEDRLDRGREKLIYEDRVDRTV
KEAEEKLTEVSQFFRDKTEKLNDELQSPEKKPRPRNGKEYSSQSSTSSSPEKVLLTELLA
SNDEWVKARQPGRDGQGFPTADEKKASSLPSSPEKKVLSEQTEDSKSTEEAKGNISQNKA
PEGPQSGFQLKQSKLSSIRLKFEQGTQAKSKDMSQEDKKPDGQSRIPVKKIQESKLPVYQ
VFAREKQQKAIDLSDESVSVQKDFMVLKAKDEHDQSNEIVVNDSGSDDVKKQRTEMSNKA
MPDYFSEQQAKDLACHVTSDLATKGPWDKKVFRTWESSGATNNKSQKEKLSHVLVHDVTE
NHIGHPESKIVDQRNEFLSVTEREHKLLTNGSLSEIKEMTVKSPSKKVLYREYVVKEGER
PGGSPDRPSRRSESSVGSHIPVRIADERRTLSTDIPDGFCELSTFPKHELSQKLPQSSMS
KETVETQHFNSLEDEKVTYSEISKVSKHQSYVGLCPPLDETEISPTKSPDSLEFSPGKES
PSSDVFDHSPIDGLERIAPLAQTEGGKEIKTLPVYVSFVQVGKQYEKEIQQGSVKKIISQ
ECKTVQETRGTFYTTRQQKQPPSPQGSPEDDTLEQVSFLDSSGKSPLTPETPSSEEVSYE
FTSKTPDSLIAYIPGKPSPIPEVSEESEEEEQAKSSSLKQTTVEETTTVAHETPNDVSKD
SNQRPKTNRVAYIEFPPPPPLDADQIESDKNHYLAEREVDMIEVNLQDEHDKYQLAEPVI
RVQPPSPVPPGADVSDSSDDESIYQPVPVKKYTFKLKEADGEQKEIAKSKASAEKSSHQK
ELETNGSGKDHEFGLGLDSPQNEAAQNGNNDQSITECSIATTAEFSHDTDATEIDSLDGY
DLQDEDDGLTESDSKLPSQTMEIKKDIWNTEGILKPVDRSFSQSKLEVIEEEGRVGPDED
KPPSKSSSEKTPDKTDQKSGAQFFTLEGRHPDRSVFPDTYFSYKVDEEFATPFKTVATKG
LDFDPWSNNRGDDEVFDSKSREDESKPFGLAVEDRSPATTPDTTPARTPTDESTPTSEPN
PFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTSEGKSGDQGEGDKNMVTATPQ
PQSGDTTIETNLERNVEAPTVEPNPSIPTSGECQEGTSSGGSLEKSAATNTNKVDPKLRT
PIKMGISASTMTMKKEGPGEVTDKIEAVMTSCQGLENETITVISNSANSHMGTRPQEKHD
FQKDNFNNNNNLDSSTIQTDNITSNVVLTEHSAPTCTTEKANPVKSSSGKKTGLLQGHCI
RDKQKVLGQQQKTKESIGIRRKSKLPVKATSPKDIFPPNPMPNIKVSKMKQVSQSEKTKT
HTSSCVDGKSRIPVKNTHRDNVVSVRKACATQKQGQPEKDKARQLPSKLPVKVRSTCVTT
TNTTTNTTTTTTTTTTTNCTVKVRKSQLKEVCKHSIEYFKGISGETLKLVDRLSEEERKM
QSELSDEEDSTSRNTSLSESSRGGQPSVTTKSARDKKTEAAPLKSKSEKAGSEKRSSRRT
GPQSPCERTDIRMAIVADHLGLSWTELARELNFVDEINQIRVENPNSLISQSFMLLKKWV
TRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGWQN
ETTSGNLESPAQARRITGGLLDRLDDSPDQCRDSITSYLKGEPGKFEANGNHAEVTPEAK
TKSYFSEPQNDIGKQSAKETLKPKIHGYGHVEEPASSLAAYQKSLEETSKFVIEEPKPCV
PVSMKKMSRTSPADGKPRLNLHEEEGSSGSEQKQGEGYKVKTKKEIRHVEKKSHS
Download sequence
Identical sequences ENSPVAP00000010571 ENSPVAP00000010571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]