SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012987 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012987
Domain Number 1 Region: 370-453
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.1e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 110-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 
Domain Number 3 Region: 191-245,273-288
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000195
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012987   Gene: ENSPVAG00000013771   Transcript: ENSPVAT00000013771
Sequence length 634
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3985:140251:200293:1 gene:ENSPVAG00000013771 transcript:ENSPVAT00000013771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAVRAEALLDDSQYIAPMVSNQMSPWTKPIAIGSFSPHVTEFPRKRKGSDSDPS
QSGIMTEKVVKNHSQNPFTYLLSTRIEISASSGSRVEDGEQQVKMKSFTEAHSQTEKRRR
DKMNNLIEELSAMLPQCKPMARKLDKLTVLRMAVQYLKSLKGMTNFYAGDNYRPSFIQEN
ELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNYDQASLTGQSFFDFLHPKDVAKVK
EQLSSSDISPREKLIDAKTGFQVNSNFQTGRTRVCSGSRRSFFCRIKSCKVSVKEEDECL
PNSKKKDHRKFCTIHCTGYLRSWPPNIIGMEEERDSQKDSNFTCLIAIGRLHPYIVPQNS
GEMIKVKPTEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSNLTDKH
KLQSKEKIFTDSYKFRAKDGSFVTLKSQWFSFXXXXXXXXXXXXXXXXXXXGHSENGEVS
LLPCSSQSLEESSRQSCISVPGMSTGTVLGAGSIGTDIANEVLDLQXXXXXXXXXXXXXX
XXXXXXXXXXXXXMSNKELIPLSPSEVGELEATMQNHSTADPPSHEPLLGDGAQLDFDAL
CDNNDTAIAAFMNYLEAEGGLGDPGDFNDIHWTL
Download sequence
Identical sequences ENSPVAP00000012987 ENSPVAP00000012987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]