SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016456 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016456
Domain Number 1 Region: 193-433
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-84
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 104-199
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000131
Family Hepsin, N-terminal domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016456   Gene: ENSPVAG00000017444   Transcript: ENSPVAT00000017446
Sequence length 437
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_904:129961:172196:1 gene:ENSPVAG00000017444 transcript:ENSPVAT00000017446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQDPDSDQPLNSLDVTPLRKPRTSLETFKKAGVPIIAALLSLAIIVIIAVVXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLSRDRSTLQVLDPAT
KNWASVCFNNFTEALAQTACRQMGFDXXXXXRAVKIGPDQDLDVVEIIANSQELQVQNPS
GPCLSGSLVSLHCLACGESLKAPRVVGGEKAPVDAWPWQVSIQYNKQHFCGGSILDHHWI
LTAAHCFRKYHDVSNWRVRAGSDKLGNFPSLPVDKIFITELNTTHPNEKDIALVKLQYPL
TFSGTVRPICLPFSDEELTPATPLWVIGWGFTEEGGGKLSDTLLQASVQVIDRTRCNAED
AYQGEVTKDMLCAGILEGGVDTCQGDSGGPLMYHSDLWQVVGIVSWGRGCGDPKTPGVYT
KVTAYLNWIYNVRKSEP
Download sequence
Identical sequences ENSPVAP00000016456 ENSPVAP00000016456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]