SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01001317001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01001317001
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily PapD-like 1.05e-44
Family MSP-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01001317001
Sequence length 238
Sequence
MSTGELLSIEPLELKFPFELKKQISCSLQLSNKTENHVVFKVKTTNPKKYCVRPNTGIVL
PRSTCDILVTMQAQKEAPSDLHCKDKFLLQSAVVTAGTSQTDITADMFNKDSGHIVEECK
LKVVYVSPPQPPSPVPEGSEEGSSPKGPSTDNGNPSGPEFASVTKALAKSQENSSETRAL
ISKLTEERNNAIRRNSKLRQELDLLKHDGKKNRGGVSFMFVAIVGLIGIIVGYFIKKT
Download sequence
Identical sequences D7TN49
GSVIVT01001317001 XP_002270502.1.54126 29760.GSVIVG00009606001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]