SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01017379001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01017379001
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 2.09e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.00096
Further Details:      
 
Domain Number 2 Region: 146-230
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.83e-26
Family Middle domain of MutM-like DNA repair proteins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01017379001
Sequence length 305
Sequence
MPELPEVEAARRAVEEHCVGKKITKAVIANDSKVIDGVSPSDFEASLLGKTIVSAHRKGK
NMWLQLDSPPFPSFQFGMAGAVYIKGVAVTKYKRSAVKDTDEWPSKYSKLFIELDDGLEL
SFTDKRRFAKVRLLEDPASVPPISELGPDALLEPMTIDEFIKSLSKKKIAIKALLLDQSY
IAGIGNWLADEVLYHARIHPLQVASSLTRESCETLHQCIKQVIQYAVEVDAECSLFPLEW
LFHFRWGKKSLRKQWKLGQIVVSFLVIGFSIPAKRSLARLLSMGRKLISSVPVAGQQPMF
QSCKS
Download sequence
Identical sequences GSVIVT01017379001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]