SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021245001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021245001
Domain Number 1 Region: 225-258
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000228
Family Rho termination factor, N-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021245001
Sequence length 262
Sequence
MVAVVFCSHSALRLQSFYAFSKPKLGKYAVSLQETADGFSPFASRRDLLPLTISSIKSDG
NRRGRPPRKNHISGRTEKGDKNKTPPSSDGKLSESSNQDEIIALFRRIQSSISKGESLGT
KKRISDSSVDKTSAESVLEILRQSRKQVKGRPSKKEGGQVLTQRRGVPKKDQGIPDKQYV
ADLKSARPPSNFVKRSPIPSPTNPRGKAVKLKNEVSVRTTSFNELPKVEEMKVTELKELA
KSRGIKGYSKMKKSELVELLRS
Download sequence
Identical sequences D7TJN8
29760.GSVIVG00035843001 GSVIVT01021245001 XP_002270114.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]