SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01024785001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01024785001
Domain Number 1 Region: 13-72
Classification Level Classification E-value
Superfamily TSP9-like 2.22e-20
Family TSP9-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01024785001
Sequence length 72
Sequence
MASLTIAFAPAAGRGILDWILGGLQKEDQMLETDPILKKVEEKNGGSNGGRKNSVVVPPK
KKGGFGGLFAKK
Download sequence
Identical sequences GSVIVT01024785001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]