SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01026354001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01026354001
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 4.19e-19
Family N-terminal domain of MutM-like DNA repair proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01026354001
Sequence length 118
Sequence
MPELPEVEAARRAVEEHCVGKKITKAVIANDSKVIDGVSPSDFEASLLGKTIVSAHRKGK
NMWLQLDSPPFPSFQFGMAGAVCIKGVAVTKYKRSAVKDTDEWPSKYSKLFIEEWRVL
Download sequence
Identical sequences D7TDT6
GSVIVT01026354001 XP_010648951.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]