SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01030280001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01030280001
Domain Number 1 Region: 464-607
Classification Level Classification E-value
Superfamily BRCA2 helical domain 1.96e-39
Family BRCA2 helical domain 0.00055
Further Details:      
 
Domain Number 2 Region: 608-737
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.51e-39
Family Single strand DNA-binding domain, SSB 0.00019
Further Details:      
 
Domain Number 3 Region: 740-769,888-973
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.48e-25
Family Single strand DNA-binding domain, SSB 0.0098
Further Details:      
 
Domain Number 4 Region: 770-888
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1e-19
Family BRCA2 tower domain 0.0031
Further Details:      
 
Domain Number 5 Region: 978-1129
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000101
Family Single strand DNA-binding domain, SSB 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01030280001
Sequence length 1134
Sequence
MSTWQIFSDSDNDFRWEISDAQSLTKPVEEASGAPIQPYDSTSRLPSMVDLLLQGCSKIL
ENDGPCVESPPMFRTGLGKSVTVKQSSIAKALSVLGDDDFGAGGAQCSLFFYHLDYLSFA
DAIGSTISFKEHCSGQDQNISQKDLLLPGPDPDHDRDNGCGFSNSLFQTGSGKMVNISSA
GLVRAKTLLGLEENSNHHSCQEHITKQSVMDGLDVPRPFSTSTSWRTESINEAVPHLKQS
EMYNPAPNPPPIKFHTAGGRSISVSSDALQRARSLLGDPELGTSLNEGDEDDMISSFLKG
SFRDASSDKENDSDTSLSHHEKAKSKHTSKSFISPIRLFPNRVQSSVMPENTYSGSNLIK
KYADDSKITCPQEPLSNRLCAPHTIIDNSVANGNCSINKPLGRSSGGPLVDVSNRIGTLL
TNKKQTITEKRRLGRRSSISPFKRPRSSKFCPPLNSNVSFVPNGLSTLASEDTCCRKRVS
TRYPFHAPRMYIKEYFGVLPFNKNVLEHLSDEVRWMNPDNAEKYMFPDEYGLGFIGVDDL
YQRLAQSGASMQYASKEWIANHYKWIIWKLACYERFYPAKHMGRFLTMSNVLEELKYRYE
REVNHGHRSAIKRILEGDASPSTMVVLCVSAIHSTCDMKIGTHSVSINGSENSNAAKVEL
TDGWYSIDAFLDALLSKQLFAGKLFIGQKLRIWGAGLCGWVGPVSPLETSKTAGLLVHIN
GTYRAHWADRLGFCKGVGPPLAFRCIKSNGGPVPQTLVRVTRIYPILYKERLSNGGSIVR
SVRMETKMMQLYNHRCSTVVEGIISEFQRGTRDSCINNDNDSEEGAKIFEILESAAEPEV
LMAEMTSEQLASFTSYQAKLEAIRQSDLQKSIEMALEGAGLSTREVTPFMRVRVVGLTCK
SYEGKIHHKEGLITIWNPTEKQQFELVEGQAYAVAGLMPLNSDSETLYLQARGSTTKWNP
LSPLAIEHFEPFLNPRKSVLLSNLGEIPLSSEFDIAALVVYVGEVYTAAHQKKQWVFVTD
GSVSELGSEEASNCLLAISFCSPSVDDSFAPVNSNLEGSTVGFVNLIKRAKDQMNQLWVA
EATENSDYFFSFDLPHCYHLKNAAASAERWAKISSLTIEKLKEKVLFIIGDCKG
Download sequence
Identical sequences GSVIVT01030280001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]