SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01037982001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01037982001
Domain Number 1 Region: 681-967
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-80
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 102-384
Classification Level Classification E-value
Superfamily L domain-like 1.28e-51
Family Polygalacturonase inhibiting protein PGIP 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01037982001
Sequence length 1037
Sequence
MNFKVKRASHHPLHLPHLGCMTTFFFFFIFSLFQGSTAQNATLDASEAEALNSIFQQWDT
QSAALWNISGEPCTGSAISGSGFEETANNPAITCDCTYNNSTTCHITQLRVYALNRRGVI
PEELTALTYLTFLKIDQNYFTGPLPSFIGNLSKLQLLSLAHNALSGTIPMELGNLQELTV
LSLSSNNFSGTLPPELGNLVNLRELYINSLGVGGEIPSTFANLENMQVMRASDCPFSGKI
PDFIGNWTKLTSLRFQGNSFEGPIPSSFSKLTSLSSLRISDLFNVSSSLDFIKDLKNLTD
LVLRNALITGSIPSYIGEFQSLQRLDLSFNNLTGGIPSSLFNLGSLANLFLGNNSLSGTL
PTQKSKQLQNIDLSYNELSGSFPSWVTSGLQLNLVANNFTFDSSNRSLLPGLNCLQRNFP
CNKNTPRYANFSIKCGGSEMRNAEGIVYEAENSTLGAASYYVTSTEKWAVSNVGLFSDRS
NPSYVDNNLMQVTGTNTPELFQSSRISPGSLRYYGLGLENGPYIVSLEFAETVFKDRDTQ
TWESLGRRVFDIYIQGALQFKDFDISKEAGGVERALEKKFYATVSENYLEIHLFWAGKGT
CCNPIQGYYGPSISALSVVSDFTPTVAGNPPIPPSKKNNTGLIVGVAVSVGVVSMILICS
VLYIKRKASYVNEDEEFLGIGPRPNTFSYSELRTATEDFNPANKLGEGGFGPVYKGTLND
GRVVAVKQLSVASQQGKSQFVAEIAAISAVQHRNLVKLYGCCIEGNRRLLVYEHLENKSL
DQALFGKNDLHLDWSTRFNICLGTARGLAYLHEDSRPRIVHRDVKASNILLDAELFPKIS
DFGLAKLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPNSD
NSLDTEKIYLLEWAWNLHENNRSLELVDPTLTAFDDSEASRIIGVALLCTQASPMLRPTM
SRVAAMLAGDIEVGIVTAKPSYLTDWDFKDITNSFLKEDSQASVASKSRKQDNTADQMPS
PVSPTEPMLHEIIGEGR
Download sequence
Identical sequences GSVIVT01037982001 XP_010655871.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]