SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01011129001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01011129001
Domain Number 1 Region: 48-415
Classification Level Classification E-value
Superfamily ARM repeat 2.91e-57
Family Armadillo repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 535-638
Classification Level Classification E-value
Superfamily POZ domain 7.22e-29
Family BTB/POZ domain 0.0032
Further Details:      
 
Weak hits

Sequence:  GSVIVT01011129001
Domain Number - Region: 365-396,440-509
Classification Level Classification E-value
Superfamily ARM repeat 0.0019
Family Armadillo repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01011129001
Sequence length 713
Sequence
MEKVGVASARKSLKRKLEEEFEEDGRLDALSQPHALRELVREVGVHVSVLNSAISSSEAD
RSAAKRAVHVLTELAKNDEIANVIVDCQVVPALVGHLQSPPPLVEGDSSPIPFEHEVEKG
CALALGLLAVKPEHQQLIVDAGALPHLVELLKRHRSGYKTRAVNSVVRRAADAITNLAHE
NSNIKTRVRIEGGIPPLVELLKFIDTKVQKAAAGALRTLAFKNDENKNQIVECNALPMLI
LMLRSEDTGVHYEAIGVIGNLVHSSPNIKKDVLFAGALQPVIELLRSSCSESQREAALLL
GQFAAADSDCKAHIVQRGAVQPLIDMLQSPDVQLREMSAFALGRLAQFMSFVGVADHHNQ
AGIAHNGGMVPLLKLLDSRNGSLQHNAAFALYGLADNEDNVADLVRVGGVQKLQEGVFNA
QPTKDCVAKTLKRLEEKIHGRVMNHLLYLMRVAEKSVQRRVVLALAHLCSLEHQKIIFID
GHGLELLLELLESTSVKHQQDASVALYKLANKATSLCVVDAAPLSPTPQVYLGEQYVNNS
TLSDVTFLVEGRKRFYAHRICLLASSDAFRAMFDGGYREKDAQDIEIPNIRWDVFELMMR
YIYTGSVDVNLDIAQDLLRAADQYLLEGLKRLCEYAIAQDISVENVSLMYELSEAFNAMT
LRHTCILYILEHFEKLTVKPWYSRLIQCILPEIRKFFREALTKPVEPVLTLST
Download sequence
Identical sequences GSVIVT01011129001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]