SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01011337001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01011337001
Domain Number 1 Region: 13-92,138-615
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 9.16e-93
Family Acetyl-CoA synthetase-like 0.00000959
Further Details:      
 
Domain Number 2 Region: 815-1165
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.62e-33
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 
Domain Number 3 Region: 633-692
Classification Level Classification E-value
Superfamily ACP-like 0.0000037
Family Peptidyl carrier domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01011337001
Sequence length 1175
Sequence
MGKKRVRENFELPEGQEWCCISHSFQRVALKNPNKIAVIQASPTAQLHNQSLASSHIPPP
YHGDRSFTFSHLFDAIDSLSFRLRSILAGAQDPFLINPTGNYLCRNQLEHAPFSLSSTSY
KPIAEQSEEIKNKEIPKILGIYMVPSVEYIIAVLSVLRCGEAFMPLDPSWPKERILSIVS
SSNVDLIIGCRSSFDTSSHFKLDKSHWLVDCNSCPVLSMSMEDKLQNHSDPSELVWPCEK
EELRLFCYLMYTSGSTGKPKGICGTEKGLLNRFLWMQEFYPLLGEEILLFKTSISFVDHL
QEFLGAILSACTLVIPPFNELKQNPFHVIDYLKAYSVTRMTAVPSLMRVIIPALQSEENM
QVQNSLKFLVLSGEILPLSLWNTLSSLLPQTSILNLYGSTEVSGDCTYFDCRRLPRILES
DSLSSVPIGIPISNCNVMLVGESDTSNEGEICVNGLCVNIGYFPDPNVMPLDYSNLSHGS
LCNCSINDNESQLYFRTGDFARRLQSGDLVFLGRKDRTVKINGQRIALEEIENALRGHPD
VVDAAVIFRKGQGELELLEAFIILKRTNESDEVLRSCIGCWMVEKLPLVMVPNNFFFTKS
FPMSATGKVDYASLAGSISMAHIQDEIGGIKSNDLLEVIKKAFCDALSVEKVCNDDDFFM
MGGDSIAAAYVSYNLGINMRLIYNFPSPSKLQVALLKKEGSSSIDVGIDDIGSLKSDTCD
LYSSKPCGTSSKPVFENNDKYPVTSKCLKVDSNTYATSKSVIPCDGCPWNSNSVPMLCSF
SRCNKVMCEVESKMKNICHTTWSIEFPRNKSGFMRELWKVHMESCVDASAIVVFKDWDIY
LLIGSHSHKFVCVNAKSGFIRWGIELEGRIECSAAILDDFSQVVVGCYSGIIYFLDFSNG
NICWTFQTRGEVKSQPVIDKRRNLVWCGSHDHYLYALNYRNHCCVYKLPCGGSIFGSPAI
DEARDILYVASTSGRVTAISLKVQPFCTLWLHELNVPVFGSLSVSSNGNVICCLVDGHVL
AFDSSGSIVWKGKTGGPIFAGACISHALPSQALICSRNGSVYSFELEGGDLLWECSVGDP
ITAAAYVDENLKLVSDSSLSSDRLVCICASSGSIHLLKISWDTTGRVHRPTEFARLELQG
EIFSSPVMIGGRIFVGCRDDYVHCIAVEAQSSLSN
Download sequence
Identical sequences GSVIVT01011337001 XP_002265371.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]