SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01014134001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01014134001
Domain Number 1 Region: 644-947
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.51e-83
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 75-370
Classification Level Classification E-value
Superfamily L domain-like 1.14e-47
Family Polygalacturonase inhibiting protein PGIP 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01014134001
Sequence length 1021
Sequence
MENLSLILLLFLGFFCFVEFTSHAQDIPEDEALNTISSKLNISAKLNNSYWSVSQSSCRE
GRDFNVNITSEIRSLVTCNCTFVNSTVCHVTNIQLKGLNLTGVLPAEFGSLKYLQELDLT
RNYFNGSIPTSFSRLPLVNLSLLGNRLSGSIPKEIGGIATLEELILEDNQLEGPLNENLG
NLGRLRRLLLSGNNFTGTIPQNFRNLKNLTDFRIDGNNLFGKIPDLIGNWTKLDKLFLQG
TSMEGPIPSTISQLKNLTELMISNLNGASMSFPDLQDMKNMTRLALRDCLITGQIPPYLG
EMKKLKILDLSFNRLTGQIPESLQSLDSIDYMFLNDNLLSGEVPRGILNWKENVDLSYNN
FTGSPPSTCQQNDVSFVSSYSSSKSSTVQWCLKKDLPCPEKPRYHSFFINCGGGKMSFEG
NEYDKDVDGRGASHFLADYLERWAYSSTGVFSKEDTAYLANNTSLKIIGPEFYQTARVAP
NSLKYYGLCLQKGSYKVRLHFAEIMFTNDQTFSSLGKRIFDVSIQGNVVLKDFNIMEEAK
GAGKGIYKDFDDVLVNGSTLEIHLYWSGKGTKSIPVRGVYGPLISAIAVTPNFDPNAGLS
VGAIIGIVMASCVVLAFILALLWTKGYLGGKDLEDKELRALELQTGYFSLRQIKAATNNF
DSANKIGEGGFGPVYKGVLSDGSIIAVKQLSSKSKQGNREFVNEIGMISALQHPNLVRLY
GCCIEGNQLLLIYEYMENNSLARALFGREEHRLHLDWPTRKKICLGIARGLAYLHEESRL
KIVHRDIKATNVLLDKDLSAKISDFGLAKLDEEENTHISTRIAGTIGYMAPEYAMRGYLT
DKADVYSFGVVALEIVSGKSNTNYRPKEEFVYLLDWAYVLHEQGNILELVDPILGSNYSE
EEAAKMLNLSLLCTNPSPTLRPSMSSVVSMLEGKIAVQAPIVKKSSMNQDMRFKAFEKLS
QDSQSHVSAFSQESQVQGSISMNGPWIDSSVSLTSREDTRDHSSSSKLLPELPDLYDVHL
D
Download sequence
Identical sequences E0CS43
GSVIVT01014134001 29760.GSVIVG00027884001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]