SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01015055001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01015055001
Domain Number 1 Region: 51-400
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.07e-118
Family IF2B-like 0.000000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01015055001
Sequence length 418
Sequence
MTWLYKFYFIFFFYNNHIYRGITLTSQQRRGIRVASFTEFKSMADSNSKHQDSLQSICYK
RGSLQLLDQRKLPLETVYLEIKGADDGWHAIRDMVVRGAPAIAIAAALSLAVEVSNLEDF
IGTSDDAASFLNSKLDYLVTSRPTAVNLSDAVTKLKGVISNAAATAFEAMSVFQAFLEAA
EDMLREDVAANRAIGLYGASFLQSHIKDSKNLSILTHCNTGSLATAGYGTALGVIRSVHA
EGILLRAYCTETRPFNQGSRLTAFELVHDNIPATLIADSAAAALMQAGRVDAVIVGADRV
AANGDTANKIGTYSLALSAKHHHIPFFVAAPLTSIDLTLSSGQEIVIEERSPKELLNSRG
GLGEQVAASGICVWNPAFDVTPADLIAGIITEKGVITKTGDVFDIKDFIHNATSHCCK
Download sequence
Identical sequences GSVIVT01015055001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]