SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01015181001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01015181001
Domain Number 1 Region: 260-365
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-19
Family Ankyrin repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 55-182
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000466
Family BTB/POZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01015181001
Sequence length 584
Sequence
MDYRAALSDSNDFSGSSSICCIAATTESLSSEVSPPDISALRRLSENLESVFESPEFDFF
TDARIVVAGGREVPVHRCILAARSVFFKAVLAGARKEKEAKFELKDLAKEFDVGYDSLVA
VLGYLYSGRVGALPKGVCACVDDDCPHSACRPAVDFMVEVLYASFAFQISELVGLYQRRL
MDILDKVASDDILVILSVANLCGKACDRLLARCIDIIIKSDVDVVTLERALPQEMVKQIV
DSRLELGFEEPESTNFPDKHVKRIHRALDSDDVELVRMLLKEGHTTLDDAYALHYAVAFG
DAKTTTELLDLGLADVNHKNHRGYTVLHIAAMRKEPKIIVSLLTKGARPTDITPDGRNAL
QIAKRLTRAVDYHKSTEEGKPSPKDQLCVEVLEQAERRDPLIGEASFSLAIAGDDLRMKL
LYLENRVGLAKLLFPMEAKVAMDIAQVDGTSEFTLTAIRPRNLADAQRTTVDLNEAPFRI
KEEHLNRLRALSKTVDLGKRFFPRCSEVLNKIMDADDLSDLAYLGNGTTEERLLKKRRYK
ELQDQLCKAFNEDKEENDKSRISSSSSSTSLGFGRNNSRLSCKK
Download sequence
Identical sequences D7TCN4
29760.GSVIVG00016536001 GSVIVT01015181001 XP_002281475.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]