SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021280001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021280001
Domain Number 1 Region: 745-1035
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.99e-82
Family Protein kinases, catalytic subunit 0.0000965
Further Details:      
 
Domain Number 2 Region: 84-346
Classification Level Classification E-value
Superfamily L domain-like 1.79e-48
Family Polygalacturonase inhibiting protein PGIP 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021280001
Sequence length 1107
Sequence
MVGFHVVPYWIILALTSCCGFVHSKLPQSEVDALARIVRTMGATYWKFDGDSCQIETVGL
TPQPPRGSEQNIICNNFLEKNNTALHVVSIMLKGYNLPGVLPPELVELQYLQEIDFAYNY
LGGTIPPEWASAQLSSISVLANRLSGEIPKELGNITSLTYLNLEANQFSGIVPPVLGDLI
NLKTLILSSNQFFGNLPTTLAGLRSLTDFRINDNNLSGPIPEFIQNWKQLTRIEMHASGL
EGPIPSNISLLDKLIQLRISDINGTTQAFPMLIKMTGIVRLILRNCKISGEIPAYIWKMK
YLEMLDVSFNNLVGEIPNDISSAKALNFIYLSSNLLSGNVPDLFLKKGSSIDLSYNNLSW
QGPGQPTCQENMNLNLNLYRSSSMENNLRAVLPCSRNVNCPRYVCSFYINCGGNDLTIKE
RRGKVVYQGDAKIEGGAANYYTSNSYWGLSSSGDFMDDNNFQNTRYIETLSSGNISGVYT
TARLSPLSLTYFGYCLENGIYTLQLHFTEIYFTDDKTYNSLGKRLFDIYIQEKLVHKNFN
IEDEAHGARNPVMKQFNASVINNILEIRFYWAGKGTTRIPYRGVYGPLISAISVYPNFKS
CSSSRKEETNAYIIGGVVGLFIIFLILGLLAWKGCLRGKKKEEKGMGYIVCKCCLVLIHC
IFCQISSIGTSALYLRLGLPRCMLFMHGINWYGFSILICNTQINLVDAFFFLFGKELRTT
KYICCYLTAYISMFPSWIDLEGLDMQTGSFTLKQIKAATKNFDFANKIGEGGFGPVYKGL
LSDGTIVAVKQLSSISRQGNREFLNEIAMISCLQHPNLVKLHGCCVEGDQLLLVYEYMEN
NSLAGALFGPENGLPNLDWPTRLKICIGIAKGLAFLHEESRIKIVHRDIKATNVLLDRDL
NPKISDFGLARLDEGEKSHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGIVALEIVSG
KHNNNYIPSNGCLCLLDWACLLQQSRKFLELVDEKLGSKVNEEEAERMIKVALLCTNASQ
SLRPTMSEVVSMLEARMPIPDMIPGPSTYTEDLRFKAMRDFRQDKRNQSLSEGRQSLNLT
GHTELELCSTSTSGPEFYEINPHSESC
Download sequence
Identical sequences GSVIVT01021280001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]