SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021285001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021285001
Domain Number 1 Region: 694-983
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.44e-82
Family Protein kinases, catalytic subunit 0.0000833
Further Details:      
 
Domain Number 2 Region: 82-352
Classification Level Classification E-value
Superfamily L domain-like 3.66e-53
Family Polygalacturonase inhibiting protein PGIP 0.00053
Further Details:      
 
Weak hits

Sequence:  GSVIVT01021285001
Domain Number - Region: 446-580
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0527
Family Proprotein convertase P-domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021285001
Sequence length 1144
Sequence
MATFPDIHGKTLFFAFILTLLILMCFGSSSVEAQGGQLPRDEEEALEEIAEQVGKKDWNF
SLNPCDGNSNWSTPNRKEKPLYNNTLTCNCSYPNGQCHVVQIFLKGQDLAGVLPPSLAKL
SYLKIIDFTRNYLSGNIPHEWASVQLEYMSLTVNRLSGPIPSFLGNITTLRYMSMENNMF
SGTVPPQLGQLVNLENLILNANNLTGELPPALANLTKLTEFRISSNNFTGKIPNFIPSWK
QLQKLEIQASGLEGPIPSSISVLKNLTELRISDLPGEGSNFPPLGNMKGLQKLMLRGCNI
FGSIPKYLAEMTELQILDLSFNKLEGIVLNLEGLTQIEFMYLTSNYLTGSIPDWIESRNN
RYQTDISYNNFSKSSMPSSCRETLNLFRSFSERGKLEFDECLNSFPCLKDQYSLHINCGG
GRTIIGDIVYEADEDLAGPSKFVPTRDNWGFSSTGDFWDRDRTTKNYIAQNVSMLGMNDS
ELYTRARLSPLSFTYYGRCLADGTYTVKLHFAEIVIRDNKSFHSLGRRIFDVYIQEKLEL
QDFNIVQAAQGVDKVVVREFKAVVRNKTLEIRFHWAGKGTTAAPEGGTYGPLISAISVKA
ENTPLNYVMQKSIPKARLHWYLTRDRINLLSYFLASSFACLGNFEPSSDGKKKIFIAVGA
VAFMIFLILGILWWKVCFGGRISREQDLEGLDMQTGSFTLKQIKAATKNFDFANKIGEGG
FGPVYKGLLSDGTIVAVKQLSSISRQGNREFLNEIAMISCLQHPNLVKLHGSCVEGDQLL
LVYEYMENNSLAGALFGPENGQPNLDWPTRLKICIGIAKGLAFLHEESRIKIVHRDIKAT
NVLLDRDLNPKISDFGLARLDEGEKSHISTRVAGTIGYMAPEYALWGYLTYKADVYSFGI
VALEIVSGKHNNNYIPSNGCLCLLDWACLLQQSRKFLELVDEKLGSKVDEEEAERMIKVA
LLCTNASQSLRPTMSEVVSMLEARMPIPDMIPGPSTYTEDLRFKAMRDFRKKNSYHFLFL
YFSFLFTLLQIFQPNILKLPSRNFTILKGIFFFLKKRISILKIKNKNYPEFSVKVLKEEI
KSSSSSFGIVALEIVSGKHNNNYIPSNDCLCLLDWACLLQQGRKFLELVDENWGLTSMKK
RQKG
Download sequence
Identical sequences GSVIVT01021285001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]