SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01021289001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01021289001
Domain Number 1 Region: 650-938
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-81
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 85-368
Classification Level Classification E-value
Superfamily L domain-like 2.27e-47
Family Polygalacturonase inhibiting protein PGIP 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01021289001
Sequence length 1008
Sequence
MATFPDIQKPLFFAFILIWLILMCFGSKAQGGRLPDDEVEALHEIAEQVGKKDWDFSLNP
CDGNANWSTPKRKEMPLYNNTLTCNCSYPNGQCHVVQIFLKGQDLAGVLPPSLEKLPYLK
MIDFTRNYLSGNIPHEWASMQLEYLSLTVNRLSGPIPSFLGNITTLRYMSLESNLFSGTV
PHQLWQLVNLENLILNTNNLTGELPPTLANLTKLTEFRISSNNFTGKIPNFIHSWKQLQK
LEIQASGLEGPIPFSISVLKNLTELRISDLPGEGSNFPSLGNMTGMKRLMLKGCNIFGSI
PKDLAKMTELQILDLSFNKLEGTVPNLEDLTKMELMYLTSNLLNGPIPDWIKSRDNRYQI
DISYNNFSEPSVPSTCGESLNLFRSFSERGKLELGKCLNSFPCSKDRYSLHINCGGEGTT
IGDVVYEADDDLAGPSEFNPIRDNWGFSSTGHFWDQNRTSKDYIAQNVSMLRMNDSELYK
RARLSPLSFTYYGRCLADGNYTVKLHFAEIVIRDNKSFHSLGRRIFDVYIQEKLELKDFN
IVQAAQGVDKAFVKEFKAVVKNKTLEIRFHWAGKGTTAAPKRGTYGPLISAISVKADFEP
PSDVKKKIFIVVGAVAVALVLFLVFGILWWKVCFGGRISREQELRGLDLQTGLFTLRQIK
AATNNFDAANKIGEGGFGSVYKGTLLDGTIIAVKQLSSKSSQGNREFVNEIGMISGLQHP
NLVRLYGCCIEGNQLLLVYEYMENNCLARALFGGGEIQLQLDWPTRQRICIGIAKGLAFL
HEESTLKIVHRDIKATNVLLDRELNPKISDFGLAKLDEEGNTHISTRIAGTIGYMAPEYA
LWGYLTYKADVYSFGVVALEIVAGKNNMKYKPNEDYVCLLDWAFVLQQKGNLMELVDPKL
GADLNKEEAKIMIKVALLCTNPSPALRPTMSAVVSMLKGQTVVPEVLIMDPSSYSDHLKF
NALRGQYDQMQLESHSVSGPLNKSLDSTTKGSSSTSSQDLYQINLDSH
Download sequence
Identical sequences GSVIVT01021289001 XP_010655574.1.54126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]