SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01029718001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01029718001
Domain Number 1 Region: 681-966
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-78
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 97-405
Classification Level Classification E-value
Superfamily L domain-like 3.2e-49
Family Polygalacturonase inhibiting protein PGIP 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01029718001
Sequence length 1031
Sequence
MKLVPGAQSVRCIFVALCSVYVIGLFHIAVAQTTEANATTDPSEVRVLNSIFQQWGISAS
NQWNTSGEPCTGAAIDSTSIDSSDYNPGIKCDCSYDNASTCHITQLKVYALDVVGVIPDE
LWNLTFLTNLNLGQNYLTGPLSASIGNLTSMQYLSMGINALSGELPKELGQLTDLRSLAF
GTNNFSGSLPSEIGNLVKLEQLYFDSSGVSGEIPSTFANLQSLTTVWASDNELTGNIPDF
IGNWSKLTVLRLQGNSFEGAIPSSFSNLTSLTDLMVSDISNASSSSLEFIKDMKLLSTLV
LRNNNISDSIPSNIGEYGSLTQLDLSFNNLSGQLPESLFNLSQLSLLFLGNNQLTGTLPS
LKSTSLLNIDLSYNGLSGSFPSWVDEENLQLNLVANNFTLDSSNSSVLPSGLNCLQQNFP
CNKGSGIYYNFAIKCGGPQITSSDQIVFERDNETLGPATYYVTDTNRWAVSNVGLFSGSN
NPQYTSRSSSQFTNTLDSELFQTARISAGSLRYYGLGLENGNYNLTLQFAETAIVNSNSW
KSLGRRVFDIYIQGDLVLKDFDIRKEAGGVSFQAVKKEFTAQVLENYIEIHLFWAGKRTC
CVPAQGTYGPSISAISATPNFEPTVPNTAPNGKKNWTGLIVGIAVALGLVCFLAVFSVYY
FVLRRKKPYENQDEELLGMDARPYTFSYAELKNATGDFSPSNKLGEGGFGPVYKGTLSDG
RVVAVKQLSVSSHQGKNQFVTEIATISAVQHRNLVKLYGCCIEGVNRSLVYEYLENKSLD
QALFGEGNLDLVWPTRYDICLGVARGLAYLHEESRLRIVHRDVKASNILLDYYLNPKISD
FGLAKLYDDTKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEIVSGRPNSDT
SLEEEKTYLLEWAWQLHETNREIELVDSRLSEFSEEEARRMIGVALLCTQTSPTLRPPMS
RVVAMLSGDIEVSRVTTKPGYLTDWKFNDVSSFMSENSDLNSPSISMEVDRDSSPLTVNK
TELHEIIGEGR
Download sequence
Identical sequences D7STA1
XP_002267129.1.54126 GSVIVT01029718001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]