SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01029720001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01029720001
Domain Number 1 Region: 753-1040
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-78
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 1829-2154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-76
Family Protein kinases, catalytic subunit 0.0000934
Further Details:      
 
Domain Number 3 Region: 1247-1554
Classification Level Classification E-value
Superfamily L domain-like 2.11e-50
Family Polygalacturonase inhibiting protein PGIP 0.0075
Further Details:      
 
Domain Number 4 Region: 157-473
Classification Level Classification E-value
Superfamily L domain-like 8.16e-45
Family Polygalacturonase inhibiting protein PGIP 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01029720001
Sequence length 2193
Sequence
MIGLDIFDWAISIGTQKKKIKDRSPQIVHWAFISNECARGLIFRLMRKRPQCVRSVTKSQ
KTTTEEKRERTTMDSVSWVFVALYGVYVIGLFHAAAAQSTEANATTDPSEVTILNSIFQQ
WGISASNEWNTSGEPCTGAALDSADIKNPGIKCDCSYDNASTCHITQLKVYALDVVGAIP
DELWNLTFLTNLNLGQNYLTGSLSASIGNLTSMQYLSLGINALSGELPKELGQLTDLRSI
AFGTNNFSGSLPSELGNLVKLEQLICCYCLTNQCYFDSSGLSGDIPSTFANLQSLTTVWA
SDNELTGNIPDFIGNWSKLTVLRLQGNSFEGSIPSSFSNLTSLTDLRISDISNGSSSSLE
FIKDMKSLSTLIIRNNNISDAIPSNIGEYGSLTQLDLSFNNLSGQLPESLFNLSQLTYLF
LGNNQLTGSLPSQKSTSLLNIDLSYNGLSGSFPSWVDEENLQLNLVANNFTLDSSNSSVL
PSGLNCLQQNFPCNRGSGIYYNFAIKCGGPQITSSDQIVFERDNETLGPATYYVTDENRW
AVSNVGLFSGSNNPQYTSTSSSQFTNTLDSELFQTARISAGSLRYYGLGLENGNYTLTLQ
FAETAIVNSNSWKSLGRRVFDVYIQGDLVLKDFDIRKEAGGVSFQAVKKEFTAQVLENYI
EIHLFWAGKGTCCVPAQGTYGPSISAISATPDFEPTVSNTAPNGKKNRTGLIVGIAVGLG
VVCFLSVFALYYFVLRRKKPSENQDEELLGMDARPYTFSYAELKNATGDFSPSNKLGEGG
FGPVYKGTLSDGRVVAVKQLSVASHQGKKQFVAEIATISAVQHRNLVKLYGCCIEGVNRS
LVYEYLENKSLDQALFGKGNGSLDLDWPTRYDICLGVARGLAYLHEESRVRIVHRDVKAS
NILLDYHRNPKISDFGLAKLYDDTKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGV
VALEIVSGRPNSDTSLEEEKTYLLEWAWQLHENNHEIELVDSRLSEFSEEEARRMIGVAL
LCTQTSPTLRPPMSRAVAMLSGDIEVSRVTTKPGYLTDWKFNDASSFMSENSHFNSSTSI
SMAADADLAKNAPYIQFIGVMKVNFALWLFELLSRHCMAFSALVNLVKKYQWEIRLGQTR
NELVKLNVSFGYVIGIQSVSCVFVALCSVYVTGLFHIAAAQTTEANATTDPSEVRVLNSI
FRQWGISASSQWRTIGEPCTGAAIDSTSIDSADYNFGIKCDCSYDNASTCHITQLKVYAL
DVVGVIPDELWNLTFLTSLNLGQNYLTGPLSASIGNLTSMQYLSLGINALSGELPKELGQ
LTDLRSFAFGTNNFSGSLPSEIGNLVKLEQLYFDSSGVSGEIPSTFANLQSLTIVWASDN
ELTGNIPDFIGNWSKLTVLRLQGNSFEGPIPSSFSNLTSLTDLRVSDISNASSSSLEFIK
NMKLLSTLVLRNNNISDSIPSNIGEYGSLTQLDLSFNNLSGQLPESLFNLSQLTYLFLGN
NQLTGTLPSLKSTSLLNIDLSYNGLSGSFPSWVDEENLQLNLVANNFTLDSSNSSVLPSG
LNCLQQNFPCNRGSGIYYNFAIKCGGPQITSSDQIVFERDSETLGPATYYVTDTNRWAFS
NVGKFSGSNNYTSTSSSLFTNTLDSELFQTARISAGSLRYYGLGLKNGNYTLTLQFAETA
IVNSNSWKTLGRRVFDIYIQGDLILKDFDIRKEAGGVSFQAVKKEFTAQVLENYIEIHLF
WAGKGTCCVPAQGTYGPSISAISATPNFEPTVPNTAPNGKKHRTGLIVGIAVALGLVCFL
AVFSVYYFVLRRKKPYENQDEELLGMEARPYTFSYAELKNATGDFSPSNKLGEGGFGPVY
KGTLSDGRVVAVKQLSVSSHQGKNQFVTEIKTISAVQHRNLVKLYGCCIEGVNRSLVYEY
LENKSLDQALFGEGNLDLVWQTRYDICLGVARGLAYLHEESRLRIVHRDVKASNILLDYY
LNPKISDFGLAKLYDDTKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEIVS
GRPNSDTSLEEEKTYLLEWHTYRLWKLDLSILAWQLHETNCELELVDSGLSEFSEEEATR
MIGVALLCTQTSPTLRPPMSHVVAMLSGDIEVSRVTTKPGYLTDWKFNDASSFMSENSDL
SSPSISMAVDTDCSALTVNKTESMRLLERAGEE
Download sequence
Identical sequences GSVIVT01029720001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]