SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01029870001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01029870001
Domain Number 1 Region: 1480-1792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-80
Family Protein kinases, catalytic subunit 0.0000612
Further Details:      
 
Domain Number 2 Region: 20-360
Classification Level Classification E-value
Superfamily L domain-like 6.46e-53
Family Polygalacturonase inhibiting protein PGIP 0.0093
Further Details:      
 
Domain Number 3 Region: 917-1257
Classification Level Classification E-value
Superfamily L domain-like 2.04e-52
Family Polygalacturonase inhibiting protein PGIP 0.008
Further Details:      
 
Domain Number 4 Region: 587-836
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.76e-51
Family Protein kinases, catalytic subunit 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01029870001
Sequence length 1821
Sequence
MLNSCLCLTAVTALRAIRRKLSDPKKRLNNWKSKDPCASNWTGVICSMNPDDGYLHVQEL
RLLNFSLNGKLAPELGLLSYMTILDFMWNNISGSIPREIGDITSLKLLLLNGNQISGSLP
EELGNLTNLNRFQVDLNNISGPLPKSFRNLTSCLHFHMNNNSISGQIPAELSSLPQLIHF
LLDNNNLSGYLPPELSQMPKLKILQLDNNNFGGTEIPESYGNMSKLLKLSLRNCNLQGSI
PNLSRIPNLHYLDLSHNQLTGSIPSNRLSNNITTIDLSSNMLSGSIPSSFSGLPHLERLS
LENNLLNGSISSAIWENVTFAANATLTLDFQNNSFSNISGSFVPPSNVTIKLNGNPLCTN
ANALNIVQFCGTANGEDEAPGSPDNSNITCPSQSCPLNDHFEYVPGSPVSCYCAAPLGVG
FRLRSPSISDFPPYTDQFKAYITSNLGLVPYQLHIDSFIWQKGPRLRMYLKFFPQYNNQS
NTFNTSEIQRIRDLITTFTIPGDDIFGPYDLLNFTLVGPYSDVDLESKKSGISKGVIVGI
VLGGLSFATAIVLVIAVVFWKKQTRHGHKDSKQQPFSKTAVIIEGVKGFSFGEMEIATEN
FSEATQIGQGGYGKVYKGILADGTVVAIKRAQQGSLQGEKEFFTEIGLLSRLHHRNLVSL
IGYCDEEQEQMLVYEFMPHGSLHSLLSGKVQRNSYFCDKIAYCIMFSQGLSDGEEGATAH
VSTVVKGTPGYLDPEYFFTHKLTEKSDVYSLGIVFLELLTGMQPISQGRNIVREVTAACQ
SGAMFSIIDQNMGPFPSDCVKEFMTLALRCSQDLTKDRPSMLEVVRELENISSMLPQAGH
GRSKSDTSASGISVMGTTAVYPGRNSYVSGFPGSDLVSGRFPSLFYFLGGGFFCFFAETT
SPSEVTALRAVKKRLIDPMKNIRNWGKGDPCTSKWKGIICKDKNTTDGYLHVNALLLLKM
NLSGTLAPELGQLSHLEIIDFLWNDLSGSIPKEIGNIAPLRLLLLSGNRLSGSLPDELGY
LLHLDRLQIDENHISGPVPKSFANLSRIKHLHMNNNSLSGRIPSELSNASTLRHLLFDNN
NLSGNLPPELSHLPELRILQLDNNNFSGAEIPISYGNLSNLVKLSLRNCSLQGAVPDFSK
IANLSYLDLSLNQLTGPIPSNKLSDNMTTIDLSGNHLNGSIQESFSDLPRLQKLLLENNL
LSGSVPTGIWQNRSLSTSAKLTVDLQNNSFSNITGDLNPPANVTLWLQGNPICSNANIVN
IHLFCGSESGGEENPESSTNSTDNCRIQECLTDDFFEYVPASPIPCFCASPLRVGYRLKS
PSFSYFIPYESPFEKYVTSVLNMELYQLHIDSFFWEEGPRLRMHFKLFPTYNNHTFNTSE
VLRIRGIFASWDFPSNDFFGPYELLSFPLLGPYSGIDSATHGKSLSMGIWVAILLGAIAC
AIAISITVTLLIVRRHSKYQNTVSRRRLSSTISMKIDGVRDFTYREMALATDNFNDSTQV
GQGGYGRVYKGILYDNTVVAIKRAQEGSLQGQKEFLTEIQLLSRLHHRNLVSLIGYCAEE
GEQMLVYEFMPNGTLRDWLSAKSKTLIFSTRLRIALGSAKGILYLHTEAQPPIFHRDIKA
SNILLDSKFTPKVADFGLSRLAPDLEDEGAVPNHVSTIVKGTPGYLDPEYFLTRKLTDKS
DVYSLGVVFLEILTGMQPISHGKNIVREVNMSHQLGMVFSIIDNKMGSYPSECVERFLAL
ALRCCHDKPEDRPSMLDVVRELENILRMMPEIETQSSESASHSGKLLSLPSSSYVSRDLY
SISNASGSDLVSGVIPTIAPR
Download sequence
Identical sequences GSVIVT01029870001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]