SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01036451001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01036451001
Domain Number 1 Region: 166-485
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.97e-92
Family IF2B-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01036451001
Sequence length 492
Sequence
MPPGISVKSGGASIEVQNEQPASSRSLKEKTSKAERRALQEAQRAAKAAAKAEVSKAPIA
ASGVATSVNAKPAKVSKLSSQKKDSASVTASEKKGVDRPPEKDRKKDVPHPRMQFDDKSR
VEKAKRRAVVRPIEVRNRVELFRHLPQYERGTLLPDLESKFFLLDPMHPAVYKVGLQYLA
GDVSGGNARCIAMLQAFQEAIKDYSTPPEKTLVRDLTARLSSYVSFLIECRPLSISMGNA
IRFLKSRIAKLPLSLSESEAKASLQSDINRFINEKIVLADKVIVRHAVTKIRDGDVLLTY
GSSSAVEMILLYAHELGKQFRVVVVDSRPKLEGQLLLRRLVGKGLSCTYTHINAVSYIMH
EVTRVFLGASSVLSNGTVYSRVGTACVSMVAHAFRVPVLVCCEAYKFYERVQLDSICSNE
LGDPDAISKVPGREEINYLDDWAKSENLQLLNLIYDATPSDYVSMIITDYGMVPPTSVPV
IVREYRREHLWI
Download sequence
Identical sequences D7SMR4
GSVIVT01036451001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]