SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01037563001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01037563001
Domain Number 1 Region: 546-847
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.13e-73
Family Protein kinases, catalytic subunit 0.0000936
Further Details:      
 
Domain Number 2 Region: 64-308,369-435
Classification Level Classification E-value
Superfamily L domain-like 4.76e-43
Family Polygalacturonase inhibiting protein PGIP 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01037563001
Sequence length 917
Sequence
MEGDQSKLWVVLILCIFRVAHCATDPSDMKILNDFRKGLENSELLKWPDDGDDPCGPPLW
PHVFCSGDRVAQIQVEGLGLKGPLPQNFNQLSMLYNLGLQRNHFNGKLPSFRGLSELQFA
FLDYNEFDTIPADFFDGLTSIRILALNDNPFNATTGWSIPDELQKSVQLTTLSLGNCNLV
GPLPEFLGTLPSLTTLKLPYNRLSGEIPASFGQSLMQILWLNDQDGGGMSGPMDVIGSMV
SLTQLWLHGNQFTGTIPESIGDLTSLRDLNLNGNKLVGLVPESLANMELQKLDLNNNHLM
GPIPKFTSGNVSYASNSFCQSEPGLQCSPEVNALLDFLAAVNYPLGLASEWSGNDPCEQP
WLGLGCNPNSKVSIVNLPNFRLNGTLSPSIGNLDSLVEIRLGGNNLTGTIPMNLTKLTSL
KKLDVSGNNFEPPVPRFQESVKVITNGNPRLAVHPEPKSTSKRLKTVIIVAAISAFAILA
MLVILLTLYCRKKRKDQVEAPSSIVVHPRDPFDPDNMVKIAVSSNTTGSLFTQTGSSIES
RDSSGVHNSHKIESGNLIISVQVLRKVTDNFAPENELGRGGFGAVYKGELEDGTKIAVKR
MEAGVVSNTALDEFQAEIAVLSKVRHRHLVSLLGHSIEGNERLLVYEFMSHGALSRHLFH
WKNLKLEPLSWKMRLSIALDVARGMEYLHGLARESFIHRDLKSSNILLGDDFRAKVADFG
LVKLAPDRGKSVATRLAGTFGYLAPEYAVMGKITTKADVFSYGVVLMELLTGLAALDEGR
SEECRYLAEWFWRIKSSKEKLMAAVDPAIGATEETFESISVVAELAGHCTAREPSHRPDM
GHAVNVLSPLVEKWKPFDNETESYSGIDYSLPLPQMLKGWQEAETKDFSHTSLEDSKGSI
PARPAGFAESFTSSDGR
Download sequence
Identical sequences GSVIVT01037563001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]