SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSVIVT01037993001 from Vitis vinifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSVIVT01037993001
Domain Number 1 Region: 1948-2264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-80
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 682-969
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-79
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 1372-1630
Classification Level Classification E-value
Superfamily L domain-like 6.46e-56
Family Polygalacturonase inhibiting protein PGIP 0.0025
Further Details:      
 
Domain Number 4 Region: 95-418
Classification Level Classification E-value
Superfamily L domain-like 2.92e-48
Family Polygalacturonase inhibiting protein PGIP 0.0034
Further Details:      
 
Domain Number 5 Region: 1205-1288
Classification Level Classification E-value
Superfamily PP2C-like 0.000000249
Family PP2C-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSVIVT01037993001
Sequence length 2282
Sequence
MNVTVKRASASPSLPRCPSIIILFFLLWLFLLFQESTAENATLDPSEAEALNSIFQQWDT
QSVALWNISGEPCTGSAINGTAFESDDNNPAIKCDCSYDSGTTCHITQLRVYALNKKGVI
PEELATLTYLTFLKIDQNYFTGPLPSFIGNLSKLSLLSIAHNAFSGTIPKELGNLTELEV
LSLGSNNFSGNLPPELGNLSKLRELYINSCGAGGEIPSTFAELLNLQVMEGSDSPFTGKI
PNFIGNFTRLTSLRFQGNSFEGPIPSSFSKLISLSSLRISDLYNVSSSLDFIRDLKNLTD
LNLRNALISGSIPSFTGEFQKLQRLDLSFNNLTGEVPSSLFNSSALTDLFLGNNSLSGSL
PAQKSEELKNIDLSYNQLSGSFPSWVTSASGLQLNLVANNFIFGSSNSSFFQGLNCLQRN
FPCNRNTPLYANFSVNCGGQEMRIADGTVYEVDNSSLGAASYYVTNTEKWAVSNVGLFSD
SSNPAYLENNLKQVADTSTPELFQTSRVSPGSLRYYGLGLENGNYTVSLEFAETKFASRS
TETWESLGRRVFDIYIQGSLQLKDFDISKEAGGVDKALEKKFNATVSENYLEIHLFWAGK
GTCCIPVQGYYGPSISALSVVSDFTPSVSGIPSIPPSKKNNTGLIVGVVVAVGSVSFILI
CAVFYMKMRASNINEDEELLGIGPRPNTFTYAELRTATEDFNPTNKLGEGGFGPVYKGKL
NDERAVAVKQLSVASHQGKSQFITEIATISAVQHRNLVKLYGCCIEGDKRLLVYEYLENK
SLDQALFGKNDLHLDWATRFNVCMGTARGLAYLHEESRPRIVHRDVKASNILLDAELCPK
ISDFGLAKLYDDKKTHISTRVAGTIGYLAPEYAMRGHLTEKADVFGFGVVALEILSGRPN
SDNSLETEKIYLLEWAWTLHESNRGLELVDPTLTAFDEDEANRIIGVALLCTQSSPLLRP
TMSRAVAMLAGDIEISAVTVKPSYLTDWDFKDITSELLDEGDTQISVASKNGSAHDHGQY
YNDDASKLAPSPINFTEPTLHETSETKFNFFIPRLPIFSLWRFLHECFYFHALINFILEI
RALLSQSSIPVFPTAQFHPATFSLSSYHHTTHLTHSFIISITSYPRTYIRHTSPCLYSHT
PSHPYIHDRDPTSISSSYPTPHLWSRHRIQMCWREPLVLAAGLQRFALFTIRDCSIVVVS
RYNMAMEILWDAIGARHAALLTSNSQLHVDSLDDNMCGTTVITVLIRGRAIYVANSGDPR
AVTVERKGKEIVAVDLSNDRYHPCRLLKSTAQNATLHPSEGTCPSSISFSLSLSPSFLIH
SLNSLFQKWDIEAVPLWNISGEPCSGSAINGTEFESEANSPAIKCDCSYDSNTTCHITQL
RVHALNKRGVIVEEFKAFTYLMVLKLDKNYFTGPLPSFIGNLSQLTYLSVSHNALSGTIP
KELGNLKELLMLSIGSNNFSGTLPPEIGNLVKLQQIYIDSSGVSGEIPSTFAKLQDMVVM
FATDVPITGKIPDFIGNWTKLESLRFQGNSLEGPIPSSFSKLTSLTTLRISDLSNVSSSL
DFIKEMKNLTDLVLRNSLISGSIPFYIGEFQSLKTLDLSFNNLTGEIPDALFNLSSLTSL
FLGTNRLSGTFPAQKSEQLQTIDLSYNELSGSFPSWLKSGLQLNLVANNLTFDSTNRSIF
EGLECLQRNFPCNRDPPPYTNVSIKCGGPEWRTPDGTVYEADNSITTGTASTSYYVSRLE
NWGVSNVGLYSDRIAYKTEVSGTNHPELFKTSRISPGSLRYYGLGLQNGHYTVSLQFAEM
ELKDQSAQTWESIGRRVFDIYIQGTLQLKDFDITKEAGGVERAIERKFNAVVSQNYLEIH
LFWAGKGTCCIPFEGYYGPSISALSVVSDLKRVPTTTPPKKGYTGLIAGIVAAIGILSFI
LIICAVFYVKWKASNLNKDIVLLGVGPRPNTFRYAELRTATENFSATNKLGEGGFGSVYK
GTLPDGRVVAVKELTVASQHGKSQFITEIATISAVQHRNLVKLYGFCIKGNRRLLVYEYL
ENRSLDHSLFGKNNLHLDWPTRFNVCLATARALAYLHEESRPRIVHRDVKASNILLDEDL
CPKISDFGLAKLYDDKKTHISTRIAGTIGYLAPEYAMRGHLTEKADVFSFGVVALEILSG
RPNTDNSLDAKMIYLLEWAWALHENNRSLDLIDPRLTAFDENEAIRVVGVALLCTQASPV
LRPTMSRVVAMLAGDIEVSTVASKPSYLTDWDFNDATSSFLSEDTQTSSAFNKSAIIQRL
PL
Download sequence
Identical sequences GSVIVT01037993001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]