SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000172 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000172
Domain Number 1 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 2.83e-27
Family Fibronectin type III 0.00000881
Further Details:      
 
Domain Number 2 Region: 1893-2060
Classification Level Classification E-value
Superfamily Fibronectin type III 6.39e-27
Family Fibronectin type III 0.00000981
Further Details:      
 
Domain Number 3 Region: 909-1079
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-23
Family Fibronectin type III 0.00065
Further Details:      
 
Domain Number 4 Region: 1634-1786
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-22
Family Fibronectin type III 0.0000121
Further Details:      
 
Domain Number 5 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 9.74e-22
Family Fibronectin type III 0.00000938
Further Details:      
 
Domain Number 6 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.46e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 8 Region: 1798-1888
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-19
Family Fibronectin type III 0.00000432
Further Details:      
 
Domain Number 9 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 4.41e-17
Family Fibronectin type III 0.0000028
Further Details:      
 
Domain Number 10 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000236
Family Fibronectin type I module 0.0021
Further Details:      
 
Domain Number 11 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 12 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000834
Family Fibronectin type III 0.00000474
Further Details:      
 
Domain Number 13 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 14 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 15 Region: 735-824
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000202
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 16 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000288
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 17 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 2327-2370
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000916
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 19 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000017
Family Fibronectin type I module 0.0002
Further Details:      
 
Domain Number 20 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000196
Family Fibronectin type I module 0.00032
Further Details:      
 
Domain Number 22 Region: 1094-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000322
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 23 Region: 2196-2258
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000117
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000172   Gene: ENSVPAG00000000185   Transcript: ENSVPAT00000000186
Sequence length 2444
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1625:133254:200421:-1 gene:ENSVPAG00000000185 transcript:ENSVPAT00000000186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGPGPGLLLLTILSLGNTVPSAGASKSRRQAQQIIQPQSPLTVGQSKPGCYDNGKHYQ
INQQWERTYLGSALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRASY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSLQTTSAGSGSFTDVRTAIYQPQPHP
QPAPYGHCVTDSGVVYLVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCVAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSESHTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPGTTGPVQVIITETPSHPNSHPIQWNAPEPSHISKYILRWKPKNSPGRWKEATIP
GHLNSYTIKGLRPGVIYEGQLISVQHYGHRELTRFDFTTTSTSSAVTSNTVTGETTPLSP
VVATSESVTEITASSFVVSWVSASDTVSGFLVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEEGEQSLILSTSQTTAPDAPPDPTVDQVNDTSIVISWRRPQAPITX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXKVPPPRDLQFVEVTDVKITIMWTPPESPVTGYRVDVIPVNLPGEHGQRLPISRNT
FVEVTGLSPGVTYLFKVFALHHGRESKPLTAQQTTKLDAPTNLRFVNETDSTVIVTWTPP
HARIAGYRLTVGLTRGGQPKQYNVGPSASQYPLRNLQPGSEYAATLVAVKGNQQSPRATG
VFTTLQPLGSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTISVLRDGQERDTPIVKKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGYSLEEVVHADQSSCTFENLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSLVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNVGPDTMRVTWAP
PPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIP
LRGRQKTGLDSPTGMDFSDITANSFTVHWMIPRAPITGFKIRHHPEHMAGRPREDRVPPS
RNSITLTNLNPGTEYVVSIIAVNGREESPPLVGQQSTVSDVPRDLEVIAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPVSIDYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPKNQTEMTIEGL
QPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRY
RVTYSSPEDGIHELFPAPDGEEETAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAI
PAPTNLKFTQVTPTSLTAQWTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGL
MVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETIT
GFQVDAIPANGQTPVQRTIKPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVVIDASTA
IDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKFEKPGSPPREVVPRPRPGVTEATITG
LEPGTEYTIQVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPF
ITNPGYDTGNGIQLPGTSGQQPSLGQQMIFEEHGFRRTTPPTTXXXXXXXXXXXPPNVNE
EIQIGHVPRGDVDHHLYPHVLGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPIGVD
EEPLQFRVPGTSASATLTGLTRGATYNIIVEALKDQKRHKIREEVVTVGNSXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWCHDNGVNYKIGE
KWDRQGENGQMMSCTCLENGKGEFKCDPHEATCYDDGKTYHVGGGWRCDNCRRPGAEPGH
EGSTGHSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences ENSVPAP00000000172 ENSVPAP00000000172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]