SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000193 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000193
Domain Number 1 Region: 203-320
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.07e-24
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 27-78
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000133
Family TS-N domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000193   Gene: ENSVPAG00000000209   Transcript: ENSVPAT00000000209
Sequence length 327
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1499:3042:7208:1 gene:ENSVPAG00000000209 transcript:ENSVPAT00000000209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPLLLQSPQPWHTFHAGPWLSSSASSKELLMKLRRKTGYSFVNCKKALETCGGDLKQAE
SWLHKQAQKEGWSKAAKLHGRKTKEGLIGLLQEGNTSVLVEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKLGENMTLKRAAWVKVPAGFYVGSYVHGAMHSPSLHNLVLGKYGALV
VCETSERKANLEDLGRRLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYLLDPSITLGQ
YVQPQGVSVVDFVRFECGEGDEAAEAE
Download sequence
Identical sequences ENSVPAP00000000193 ENSVPAP00000000193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]